Structural Investigations of the Substrate Specificity of Human O-GlcNAcase. Determined by X-ray diffraction at 2.7 Å resolution. Released 27 Sept 2017.
Explore 5VVU in 3D Show helices and sheets RCSB PDB PDBe
5VVU contains 50 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 61-66 | 6 | 1 |
| α-helix | 72-74 | 3 | |
| α-helix | 75-87 | 13 | |
| β-strand | 92-95 | 4 | 1 |
| α-helix | 101-105 | 5 | |
| α-helix | 110-111 | 2 | |
| α-helix | 113-128 | 16 | |
| β-strand | 132-137 | 6 | 1 |
| α-helix | 148-162 | 15 | |
| β-strand | 168-172 | 5 | 1 |
| α-helix | 182-185 | 4 | |
| α-helix | 191-205 | 15 | |
| β-strand | 212-215 | 4 | 1 |
| α-helix | 221-223 | 3 | |
| α-helix | 232-240 | 9 | |
| β-strand | 246-249 | 4 | 1 |
| α-helix | 261-271 | 11 | |
| α-helix | 274-275 | 2 | |
| β-strand | 276-279 | 4 | 1 |
| α-helix | 295-296 | 2 | |
| α-helix | 301-306 | 6 | |
| β-strand | 309-312 | 4 | 1 |
| α-helix | 318-321 | 4 | |
| α-helix | 322-332 | 11 | |
| α-helix | 376-387 | 12 | |
| α-helix | 388-390 | 3 | |
| α-helix | 393-395 | 3 | |
| α-helix | 555-564 | 10 | |
| β-strand | 567 | 1 | 2 |
| β-strand | 570 | 1 | 2 |
| α-helix | 573-587 | 15 | |
| α-helix | 588-591 | 4 | |
| α-helix | 606-629 | 24 | |
| α-helix | 634-662 | 29 | |
| α-helix | 684-690 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 61-66 | 6 | 3 |
| α-helix | 72-74 | 3 | |
| α-helix | 75-87 | 13 | |
| β-strand | 92-95 | 4 | 3 |
| α-helix | 110-111 | 2 | |
| α-helix | 113-128 | 16 | |
| β-strand | 132-137 | 6 | 3 |
| α-helix | 148-165 | 18 | |
| β-strand | 168-172 | 5 | 3 |
| α-helix | 182-187 | 6 | |
| α-helix | 191-205 | 15 | |
| β-strand | 212-215 | 4 | 3 |
| α-helix | 221-223 | 3 | |
| α-helix | 228-230 | 3 | |
| α-helix | 232-240 | 9 | |
| β-strand | 246-249 | 4 | 3 |
| β-strand | 259 | 1 | 4 |
| α-helix | 261-271 | 11 | |
| α-helix | 274-275 | 2 | |
| β-strand | 276-279 | 4 | 3 |
| α-helix | 295-296 | 2 | |
| β-strand | 299 | 1 | 4 |
| α-helix | 301-306 | 6 | |
| β-strand | 309-312 | 4 | 3 |
| α-helix | 318-320 | 3 | |
| α-helix | 321-334 | 14 | |
| α-helix | 376-388 | 13 | |
| α-helix | 555-564 | 10 | |
| β-strand | 567 | 1 | 5 |
| β-strand | 570 | 1 | 5 |
| α-helix | 573-587 | 15 | |
| α-helix | 589-591 | 3 | |
| α-helix | 605-629 | 25 | |
| α-helix | 634-662 | 29 | |
| α-helix | 663-666 | 4 | |
| α-helix | 678-680 | 3 | |
| α-helix | 684-690 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein O-GlcNAcase | A, C | protein | 504 | Homo sapiens | O60502 (AlphaFold model) |
| TAB1 peptide | B, D | protein | 7 | Homo sapiens | Q15750 (AlphaFold model) |
>5VVU_1 Protein O-GlcNAcase (chains A, C) HFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQ LMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDNIDH NMCAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVG EKLLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKG RSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIK LENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRGGGGSGGGGSVTLEDLQL LADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGL VMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWA FRGGLAGEFQRLLPIDGANDLFFQ
>5VVU_2 TAB1 peptide (chains B, D) VPYSSAQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural insights into the substrate binding adaptability and specificity of human O-GlcNAcase. Li, B., Li, H., Hu, C.W. et al. Nat Commun (2017) 8:666-666. DOI 10.1038/s41467-017-00865-1 · PubMed
Other PDB entries of the same protein (UniProt O60502 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.