7SN6: U2AF65 uhm

U2AF65 uhm bound to SF3B155 ULM5. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jul 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,883
Mol. weight: 28.5 kDa
Ligands: IPA
Released: 27 Jul 2022

Explore 7SN6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SN6 contains 10 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	377-381	5	1
α-helix	386-389	4
α-helix	392-406	15
β-strand	412-416	5	1
β-strand	432-436	5	1
α-helix	439-449	11
β-strand	453-454	2	2
β-strand	457-458	2	2
β-strand	460-464	5	1
α-helix	466-471	6

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	377-381	5	3
α-helix	386-389	4
α-helix	392-406	15
β-strand	412-416	5	3
β-strand	421	1	4
β-strand	424	1	4
β-strand	432-436	5	3
α-helix	439-449	11
β-strand	453-454	2	5
β-strand	457-458	2	5
β-strand	460-463	4	3
α-helix	466-470	5

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	338	1	2
α-helix	343-345	3

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	338	1	5
α-helix	340-342	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A, B	protein	106	Homo sapiens	P26368 (AlphaFold model)
Splicing factor 3B subunit 1	C, D	protein	19	Homo sapiens	O75533 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7SN6_1 Splicing factor U2AF 65 kDa subunit (chains A, B)
GPLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGC
GKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Sequence of entity 2 (C, D), FASTA

>7SN6_2 Splicing factor 3B subunit 1 (chains C, D)
KRKSRWDETPASQMGGSTP

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1

Primary citation

A UHM-ULM interface with unusual structural features contributes to U2AF2 and SF3B1 association for pre-mRNA splicing. Galardi, J.W., Bela, V.N., Jeffery, N. et al. J Biol Chem (2022) 298:102224-102224. DOI 10.1016/j.jbc.2022.102224 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site

Browse structure collections

About this viewer

MolViewer shows 7SN6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.