X-ray structure of ankyrin repeat domain of DHHC17 in complex with Snap25b peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Aug 2017.
Explore 5W7I in 3D Show helices and sheets RCSB PDB PDBe
5W7I contains 28 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 61-66 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 93-99 | 7 | |
| α-helix | 103-111 | 9 | |
| β-strand | 120 | 1 | 1 |
| β-strand | 125 | 1 | 1 |
| α-helix | 127-134 | 8 | |
| α-helix | 137-145 | 9 | |
| α-helix | 160-166 | 7 | |
| α-helix | 170-178 | 9 | |
| α-helix | 193-200 | 8 | |
| α-helix | 207-211 | 5 | |
| β-strand | 220 | 1 | 2 |
| β-strand | 227 | 1 | 2 |
| α-helix | 228-234 | 7 | |
| α-helix | 238-246 | 9 | |
| β-strand | 254 | 1 | 3 |
| β-strand | 260 | 1 | 3 |
| α-helix | 261-267 | 7 | |
| α-helix | 271-278 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 61-66 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 93-99 | 7 | |
| α-helix | 103-111 | 9 | |
| β-strand | 120 | 1 | 4 |
| β-strand | 125 | 1 | 4 |
| α-helix | 127-134 | 8 | |
| α-helix | 137-145 | 9 | |
| α-helix | 160-166 | 7 | |
| α-helix | 170-178 | 9 | |
| α-helix | 193-200 | 8 | |
| α-helix | 207-212 | 6 | |
| β-strand | 220 | 1 | 5 |
| β-strand | 227 | 1 | 5 |
| α-helix | 228-234 | 7 | |
| α-helix | 238-246 | 9 | |
| α-helix | 261-267 | 7 | |
| α-helix | 271-280 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Palmitoyltransferase ZDHHC17 | A, C | protein | 239 | Homo sapiens | Q8IUH5 (AlphaFold model) |
| Snap25b-111-120 | B, D | protein | 10 | Homo sapiens | P60880 (AlphaFold model) |
>5W7I_1 Palmitoyltransferase ZDHHC17 (chains A, C) GPHMKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDL VKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAA QFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHK NTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAK
>5W7I_2 Snap25b-111-120 (chains B, D) GVVASQPARV
Structural Basis for Substrate Recognition by the Ankyrin Repeat Domain of Human DHHC17 Palmitoyltransferase. Verardi, R., Kim, J.S., Ghirlando, R. et al. Structure (2017) 25:1337-1347.e6. DOI 10.1016/j.str.2017.06.018 · PubMed
Other PDB entries of the same protein (UniProt Q8IUH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5W7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.