5W7J: E89A variant of ankyrin repeat domain of DHHC17

X-ray structure of the E89A variant of ankyrin repeat domain of DHHC17 in complex with Snap25b peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Aug 2017.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,811
Mol. weight: 55.26 kDa
Released: 9 Aug 2017

Explore 5W7J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W7J contains 28 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	61-66	6
α-helix	70-78	9
α-helix	93-99	7
α-helix	103-111	9
β-strand	120	1	1
β-strand	125	1	1
α-helix	127-134	8
α-helix	137-145	9
α-helix	160-166	7
α-helix	170-178	9
α-helix	193-200	8
α-helix	207-211	5
β-strand	220	1	2
β-strand	227	1	2
α-helix	228-235	8
α-helix	238-246	9
β-strand	254	1	3
β-strand	260	1	3
α-helix	261-267	7
α-helix	271-279	9

Chain C: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	61-66	6
α-helix	70-78	9
α-helix	93-99	7
α-helix	103-111	9
β-strand	120	1	4
β-strand	125	1	4
α-helix	127-134	8
α-helix	137-145	9
α-helix	160-166	7
α-helix	170-178	9
α-helix	193-200	8
α-helix	207-212	6
β-strand	220	1	5
β-strand	227	1	5
α-helix	228-234	7
α-helix	238-246	9
β-strand	254	1	6
β-strand	260	1	6
α-helix	261-267	7
α-helix	271-280	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Palmitoyltransferase ZDHHC17	A, C	protein	239	Homo sapiens	Q8IUH5 (AlphaFold model)
Snap25b-111-120	B, D	protein	10	Homo sapiens	P60880 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5W7J_1 Palmitoyltransferase ZDHHC17 (chains A, C)
GPHMKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKANVTLLHWAAINNRIDL
VKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAA
QFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHK
NTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAK

Sequence of entity 2 (B, D), FASTA

>5W7J_2 Snap25b-111-120 (chains B, D)
GVVASQPARV

Primary citation

Structural Basis for Substrate Recognition by the Ankyrin Repeat Domain of Human DHHC17 Palmitoyltransferase. Verardi, R., Kim, J.S., Ghirlando, R. et al. Structure (2017) 25:1337-1347.e6. DOI 10.1016/j.str.2017.06.018 · PubMed

Other PDB entries of the same protein (UniProt Q8IUH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EU9 1.99 Å, The ankyrin repeat domain of Huntingtin interacting protein 14
5W7I 2.1 Å, X-ray structure of ankyrin repeat domain of DHHC17 in complex with Snap25b peptide

Browse structure collections

About this viewer

MolViewer shows 5W7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.