5W7X: FHA domain of human APLF

Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 May 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,638
Mol. weight: 52.14 kDa
Released: 2 May 2018

Explore 5W7X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W7X contains 11 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	4
β-strand	16-18	3	4
β-strand	21-25	5	5
β-strand	27-28	2	6
β-strand	33	1	6
β-strand	43-48	6	5
β-strand	51-56	6	5
α-helix	61-62	2
β-strand	63-65	3	4
β-strand	73-74	2	4
α-helix	75-76	2
β-strand	81-83	3	5
β-strand	88-92	5	4
β-strand	95-102	8	4

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	7
β-strand	16-18	3	7
α-helix	19	1
β-strand	21-25	5	8
β-strand	27-28	2	9
β-strand	33	1	9
β-strand	43-48	6	8
β-strand	51-56	6	8
α-helix	61-62	2
β-strand	63-65	3	7
β-strand	73-74	2	7
α-helix	75-76	2
β-strand	81-83	3	8
β-strand	88-90	3	7
β-strand	97-102	6	7

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	10
α-helix	13-15	3
β-strand	16-17	2	10
α-helix	18-19	2
β-strand	21-25	5	11
β-strand	27-28	2	12
β-strand	33	1	12
β-strand	43-48	6	11
β-strand	51-56	6	11
β-strand	63-65	3	10
β-strand	73-74	2	10
α-helix	75-76	2
β-strand	81-83	3	11
β-strand	88-92	5	10
β-strand	95-102	8	10

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	16-17	2	1
β-strand	21-25	5	2
β-strand	27-28	2	3
β-strand	33	1	3
β-strand	43-48	6	2
β-strand	51-56	6	2
β-strand	63-65	3	1
β-strand	73-74	2	1
α-helix	75-76	2
β-strand	81-82	2	2
β-strand	88-92	5	1
β-strand	95-102	8	1

Chains E and G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	518-520	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aprataxin and PNK-like factor	A, B, C, D	protein	108	Homo sapiens	Q8IW19 (AlphaFold model)
DNA repair protein XRCC1	E, F, G, H	protein	9	Homo sapiens	P18887 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5W7X_1 Aprataxin and PNK-like factor (chains A, B, C, D)
SFTMSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPI
HTNPCFYQSSEKSQLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPS

Sequence of entity 2 (E, F, G, H), FASTA

>5W7X_2 DNA repair protein XRCC1 (chains E, F, G, H)
PYAGSTDEN

Primary citation

Characterization of the APLF FHA-XRCC1 phosphopeptide interaction and its structural and functional implications. Kim, K., Pedersen, L.C., Kirby, T.W. et al. Nucleic Acids Res (2017) 45:12374-12387. DOI 10.1093/nar/gkx941 · PubMed

Other PDB entries of the same protein (UniProt Q8IW19 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W7W 1.35 Å, Crystal Structure of FHA domain of human APLF
5E50 1.38 Å, APLF/XRCC4 complex
6TYZ 1.51 Å, Structure of Ku80 von Willebrand domain complexed with APLF Ku Binding Motif
6TYW 1.7 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF Ku Binding Motif
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
6YN1 2.35 Å, Crystal structure of histone chaperone APLF acidic domain bound to the histone…
6TYT 2.4 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF and XLF Ku…
6ERF 3.01 Å, Complex of APLF factor and Ku heterodimer bound to DNA
2KQB First PBZ domain of human APLF protein
2KQC Second PBZ domain of human APLF protein
2KQD First PBZ domain of human APLF protein in complex with ribofuranosyladenosine
2KQE Second PBZ domain of human APLF protein in complex with ribofuranosyladenosine

Browse structure collections

About this viewer

MolViewer shows 5W7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.