5WH1: Transcription initiation factor IIB

Name: PDB 5WH1: Apo form of the C-terminal region of human Transcription Factor IIB
Published: 2017-11-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Apo form of the C-terminal region of human Transcription Factor IIB. Determined by X-ray diffraction at 3.39 Å resolution. Released 29 Nov 2017.

Method: X-ray diffraction
Resolution: 3.39 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,640
Mol. weight: 96.51 kDa
Released: 29 Nov 2017

Explore 5WH1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WH1 contains 58 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	109-127	19
α-helix	132-145	14
α-helix	149-151	3
α-helix	156-170	15
α-helix	177-183	7
α-helix	188-202	15
α-helix	213-222	10
α-helix	226-241	16
α-helix	250-264	15
α-helix	271-278	8
α-helix	282-292	11
α-helix	293-295	3
α-helix	296-299	4
α-helix	314-315	2

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	109-127	19
α-helix	132-146	15
α-helix	149-151	3
α-helix	156-170	15
α-helix	177-183	7
α-helix	188-203	16
α-helix	213-222	10
α-helix	226-241	16
α-helix	250-264	15
α-helix	271-278	8
α-helix	282-292	11
α-helix	293-295	3
α-helix	296-299	4
α-helix	314-315	2

Chains C and D: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	109-127	19
α-helix	132-146	15
α-helix	149-151	3
α-helix	156-170	15
α-helix	177-183	7
α-helix	188-201	14
α-helix	202-204	3
α-helix	213-222	10
α-helix	226-241	16
α-helix	250-264	15
α-helix	271-278	8
α-helix	282-292	11
α-helix	293-295	3
α-helix	296-299	4
α-helix	313-315	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor IIB	A, B, C, D	protein	211	Homo sapiens	Q00403 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5WH1_1 Transcription initiation factor IIB (chains A, B, C, D)
SMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLY
IACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLP
KQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTI
RQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

Primary citation

Structural dissection of an interaction between transcription initiation and termination factors implicated in promoter-terminator cross-talk. Bratkowski, M., Unarta, I.C., Zhu, L. et al. J Biol Chem (2018) 293:1651-1665. DOI 10.1074/jbc.M117.811521 · PubMed

Other PDB entries of the same protein (UniProt Q00403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
1C9B 2.65 Å, Crystal structure of a human tbp core domain-human tfiib core domain complex bound to an…
1VOL 2.7 Å, Tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
7ZWD 3.0 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U5 snRNA promoter…
7ZX8 3.0 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U1 snRNA promoter…
8S51 3.1 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 8 nt
7ZWC 3.2 Å, Structure of SNAPc:TBP-TFIIA-TFIIB sub-complex bound to U5 snRNA promoter
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
7ZX7 3.4 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U1 snRNA promoter…

Browse structure collections

About this viewer

MolViewer shows 5WH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.