Solution structure of the pseudo-receiver domain of Atg32. Determined by solution NMR. Released 4 Jul 2018.
Explore 5WLP in 3D Show helices and sheets RCSB PDB PDBe
5WLP contains 8 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 1 |
| β-strand | 15 | 1 | 1 |
| α-helix | 18-20 | 3 | |
| β-strand | 23-27 | 5 | 2 |
| α-helix | 34-36 | 3 | |
| α-helix | 39-42 | 4 | |
| β-strand | 45-46 | 2 | 2 |
| β-strand | 61-65 | 5 | 2 |
| α-helix | 69-81 | 13 | |
| β-strand | 86-87 | 2 | 3 |
| β-strand | 89-91 | 3 | 2 |
| β-strand | 92 | 1 | 4 |
| α-helix | 97-103 | 7 | |
| α-helix | 105-108 | 4 | |
| β-strand | 113-114 | 2 | 3 |
| β-strand | 121 | 1 | 4 |
| α-helix | 128-131 | 4 | |
| α-helix | 133-142 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autophagy-related protein 32 | A | protein | 145 | Saccharomyces cerevisiae | P40458 (AlphaFold model) |
>5WLP_1 Autophagy-related protein 32 (chains A) SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYT GIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPV VVTNKRDLKKMFQRLQDLSLEYGED
A pseudo-receiver domain in Atg32 is required for mitophagy. Xia, X., Katzenell, S., Reinhart, E.F. et al. Autophagy (2018) 14:1620-1628. DOI 10.1080/15548627.2018.1472838 · PubMed
Other PDB entries of the same protein (UniProt P40458 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WLP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.