3VXW: Saccharomyces cerevisiae Atg8

Crystal structure of Saccharomyces cerevisiae Atg8 complexed with Atg32 AIM. Determined by X-ray diffraction at 3.0 Å resolution. Released 3 Oct 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 926
Mol. weight: 14.68 kDa
Released: 3 Oct 2012

Explore 3VXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VXW contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-80	4	1
β-strand	83	1	1
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	87-88	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 8	A	protein	119	Saccharomyces cerevisiae	P38182 (AlphaFold model)
Peptide from Autophagy-related protein 32	B	protein	6	Saccharomyces cerevisiae	P40458 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VXW_1 Autophagy-related protein 8 (chains A)
GAHMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTV
GQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG

Sequence of entity 2 (B), FASTA

>3VXW_2 Peptide from Autophagy-related protein 32 (chains B)
SWQAIQ

Primary citation

Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy. Kondo-Okamoto, N., Noda, N.N., Suzuki, S.W. et al. J Biol Chem (2012) 287:10631-10638. DOI 10.1074/jbc.M111.299917 · PubMed

Other PDB entries of the same protein (UniProt P38182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WY6 1.77 Å, Crystal structure of S. cerevisiae Atg8 in complex with Ede1 (1220-1247)
3RUI 1.91 Å, Crystal structure of Atg7C-Atg8 complex
3VH3 2.0 Å, Crystal structure of Atg7CTD-Atg8 complex
5YEC 2.15 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex in form II
7BRN 2.23 Å, Crystal structure of Atg40 AIM fused to Atg8
6AAG 2.44 Å, Crystal structure of budding yeast Atg8 complexed with the helical AIM of Hfl1.
3VH4 2.65 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex
2ZPN 2.7 Å, The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
2KQ7 Solution structure of the Autophagy-Related Protein Atg8
2KWC The NMR structure of the autophagy-related protein Atg8
2LI5 NMR structure of Atg8-Atg7C30 complex

Browse structure collections

About this viewer

MolViewer shows 3VXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.