5WRD: LC3B

Crystal structure of LC3B in complex with FYCO1 LIR. Determined by X-ray diffraction at 1.9 Å resolution. Released 29 Mar 2017.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,314
Mol. weight: 33.83 kDa
Released: 29 Mar 2017

Explore 5WRD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WRD contains 14 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-70	11
β-strand	80-83	4	1
β-strand	87	1	1
β-strand	94	1	2
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	1
β-strand	119	1	3

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	4
α-helix	45-46	2
β-strand	47	1	3
β-strand	51-55	5	4
β-strand	59	1	5
α-helix	60-70	11
β-strand	79-83	5	4
β-strand	87	1	4
β-strand	94	1	5
α-helix	95-102	8
β-strand	109-115	7	4

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1240-1241	2	1
α-helix	1242-1243	2
α-helix	1244-1252	9

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1240-1241	2	4
α-helix	1244-1252	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3B	A, B	protein	125	Mus musculus	Q9CQV6 (AlphaFold model)
Peptide from FYVE and coiled-coil domain-containing protein 1	C, D	protein	19	Mus musculus	Q8VDC1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WRD_1 Microtubule-associated proteins 1A/1B light chain 3B (chains A, B)
MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
TAMAV

Sequence of entity 2 (C, D), FASTA

>5WRD_2 Peptide from FYVE and coiled-coil domain-containing protein 1 (chains C, D)
DDAVFDIITDEELCQIQES

Primary citation

The crystal structure of mouse LC3B in complex with the FYCO1 LIR reveals the importance of the flanking region of the LIR motif. Sakurai, S., Tomita, T., Shimizu, T. et al. Acta Crystallogr F Struct Biol Commun (2017) 73:130-137. DOI 10.1107/S2053230X17001911 · PubMed

Other PDB entries of the same protein (UniProt Q9CQV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9W1U 1.6 Å, Crystal structure of mutant apo LC3B
9W2N 1.67 Å, Crystal structure of the mutant LC3B in complex with p62
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
5YIQ 2.6 Å, Crystal structure of AnkG LIR/LC3B complex

Browse structure collections

About this viewer

MolViewer shows 5WRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.