5WXG: TAF PHD finger domain binds to H3(1-15)K4ac

Structure of TAF PHD finger domain binds to H3(1-15)K4ac. Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Aug 2017.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 632
Mol. weight: 8.26 kDa
Ligands: MG, ZN
Released: 16 Aug 2017

Explore 5WXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WXG contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	858-860	3	1
β-strand	866-868	3	1
β-strand	869	1	2
β-strand	876	1	2
β-strand	882-884	3	3
β-strand	891-893	3	3
α-helix	894-897	4
α-helix	902-904	3

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-4	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 3	A	protein	63	Homo sapiens	Q5VWG9 (AlphaFold model)
Histone H3K4ac	P	protein	7	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5WXG_1 Transcription initiation factor TFIID subunit 3 (chains A)
SMYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC
ANK

Sequence of entity 2 (P), FASTA

>5WXG_2 Histone H3K4ac (chains P)
ARTKQTA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	2

Primary citation

Kinetic and high-throughput profiling of epigenetic interactions by 3D-carbene chip-based surface plasmon resonance imaging technology. Zhao, S., Yang, M., Zhou, W. et al. Proc Natl Acad Sci U S A (2017) 114:E7245-E7254. DOI 10.1073/pnas.1704155114 · PubMed

Other PDB entries of the same protein (UniProt Q5VWG9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WXH 1.3 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3
5XMY 1.7 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3Q5ser
5C13 2.1 Å, Crystal Structure of TAF3 PHD finger bound to histone H3C4me3 peptide
7EGF 3.16 Å, TFIID lobe A subcomplex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
7EG9 3.7 Å, TFIID-based intermediate PIC on SCP promoter
7EGC 3.9 Å, p53-bound TFIID-based holo PIC on HDM2 promoter
7ENA 4.07 Å, TFIID-based PIC-Mediator holo-complex in pre-assembled state (pre-hPIC-MED)
7EGA 4.1 Å, TFIID-based intermediate PIC on PUMA promoter
7ENC 4.13 Å, TFIID-based PIC-Mediator holo-complex in fully-assembled state (hPIC-MED)
8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
7EDX 4.5 Å, p53-bound TFIID-based core PIC on HDM2 promoter

Browse structure collections

About this viewer

MolViewer shows 5WXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.