Crystal structure of human DEAH-box RNA helicase DHX15 in complex with ADP. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Jun 2017.
Explore 5XDR in 3D Show helices and sheets RCSB PDB PDBe
5XDR contains 38 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 115-116 | 2 | 1 |
| β-strand | 121-122 | 2 | 1 |
| α-helix | 125-134 | 10 | |
| α-helix | 138-142 | 5 | |
| α-helix | 143-150 | 8 | |
| β-strand | 155-160 | 6 | 2 |
| α-helix | 166-179 | 14 | |
| β-strand | 187-192 | 6 | 2 |
| α-helix | 195-208 | 14 | |
| β-strand | 213 | 1 | 2 |
| β-strand | 217-221 | 5 | 2 |
| β-strand | 224-226 | 3 | 2 |
| β-strand | 233-237 | 5 | 2 |
| α-helix | 238-246 | 9 | |
| β-strand | 254-259 | 6 | 2 |
| α-helix | 262-264 | 3 | |
| α-helix | 267-282 | 16 | |
| β-strand | 287-292 | 6 | 2 |
| β-strand | 309-312 | 4 | 2 |
| β-strand | 319-322 | 4 | 3 |
| α-helix | 331-345 | 15 | |
| β-strand | 351-355 | 5 | 3 |
| α-helix | 361-367 | 7 | |
| α-helix | 381-382 | 2 | |
| β-strand | 383-388 | 6 | 3 |
| α-helix | 394-397 | 4 | |
| α-helix | 403-408 | 6 | |
| β-strand | 415-420 | 6 | 3 |
| α-helix | 423-426 | 4 | |
| β-strand | 433-438 | 6 | 3 |
| β-strand | 441-448 | 8 | 4 |
| β-strand | 453-460 | 8 | 4 |
| α-helix | 461-462 | 2 | |
| α-helix | 463-471 | 9 | |
| α-helix | 472-474 | 3 | |
| β-strand | 479-483 | 5 | 3 |
| α-helix | 488-491 | 4 | |
| α-helix | 498-500 | 3 | |
| α-helix | 501-503 | 3 | |
| α-helix | 508-516 | 9 | |
| α-helix | 530-532 | 3 | |
| α-helix | 533-545 | 13 | |
| β-strand | 549 | 1 | 5 |
| α-helix | 554 | 1 | |
| β-strand | 555 | 1 | 5 |
| α-helix | 556 | 1 | |
| α-helix | 557-562 | 6 | |
| α-helix | 569-578 | 10 | |
| α-helix | 579-581 | 3 | |
| α-helix | 584-594 | 11 | |
| β-strand | 600 | 1 | 6 |
| α-helix | 604-606 | 3 | |
| α-helix | 607-615 | 9 | |
| β-strand | 619 | 1 | 7 |
| β-strand | 622 | 1 | 7 |
| α-helix | 623-636 | 14 | |
| α-helix | 641-646 | 6 | |
| β-strand | 649 | 1 | 6 |
| α-helix | 651-670 | 20 | |
| α-helix | 684-697 | 14 | |
| β-strand | 701-704 | 4 | 7 |
| β-strand | 710-712 | 3 | 7 |
| β-strand | 718-721 | 4 | 7 |
| β-strand | 733-741 | 9 | 7 |
| β-strand | 745-752 | 8 | 7 |
| α-helix | 755-761 | 7 | |
| α-helix | 768-770 | 3 | |
| α-helix | 775-788 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 | A | protein | 690 | Homo sapiens | O43143 (AlphaFold model) |
>5XDR_1 Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 (chains A) GPEFSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSG KTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFED CSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSD LKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMC EEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPP PKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKAS AQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHF DFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSN EVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCY DNFINYRSLMSADNVRQQLSRIMDRFNLPRRSSDFTSRDYYINIRKALVTGYFMQVAHLE RTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQY YDMSNFPQCEAKRQLDRIIAKLQSKEYSQY
Water and common crystallization additives (SO4) are not listed.
The crystal structure of human DEAH-box RNA helicase 15 reveals a domain organization of the mammalian DEAH/RHA family. Murakami, K., Nakano, K., Shimizu, T. et al. Acta Crystallogr F Struct Biol Commun (2017) 73:347-355. DOI 10.1107/S2053230X17007336 · PubMed
Other PDB entries of the same protein (UniProt O43143 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.