Structure of the N-terminal domains of PHF1. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Sept 2017.
Explore 5XFO in 3D Show helices and sheets RCSB PDB PDBe
5XFO contains 19 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-40 | 5 | 1 |
| β-strand | 46-55 | 10 | 1 |
| β-strand | 60-65 | 6 | 1 |
| β-strand | 70-74 | 5 | 1 |
| α-helix | 75-77 | 3 | |
| β-strand | 78-80 | 3 | 1 |
| α-helix | 81-83 | 3 | |
| β-strand | 90 | 1 | 2 |
| β-strand | 99 | 1 | 3 |
| β-strand | 102 | 1 | 3 |
| β-strand | 104-106 | 3 | 2 |
| β-strand | 113-115 | 3 | 2 |
| α-helix | 116-118 | 3 | |
| α-helix | 122-125 | 4 | |
| α-helix | 137-144 | 8 | |
| α-helix | 155-163 | 9 | |
| α-helix | 171-173 | 3 | |
| β-strand | 176 | 1 | 4 |
| β-strand | 183 | 1 | 4 |
| β-strand | 201-203 | 3 | 5 |
| β-strand | 204 | 1 | 6 |
| β-strand | 210-212 | 3 | 5 |
| α-helix | 213-215 | 3 | |
| α-helix | 222-224 | 3 | |
| β-strand | 230-233 | 4 | 6 |
| α-helix | 235-238 | 4 | |
| β-strand | 243-246 | 4 | 6 |
| α-helix | 247-250 | 4 | |
| α-helix | 251-266 | 16 | |
| β-strand | 271-272 | 2 | 7 |
| α-helix | 273-277 | 5 | |
| α-helix | 278-283 | 6 | |
| α-helix | 285-288 | 4 | |
| α-helix | 291-293 | 3 | |
| α-helix | 299-311 | 13 | |
| β-strand | 316-321 | 6 | 7 |
| α-helix | 322-324 | 3 | |
| β-strand | 326-331 | 6 | 7 |
| α-helix | 336-338 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 1 | A | protein | 316 | Homo sapiens | O43189 (AlphaFold model) |
>5XFO_1 PHD finger protein 1 (chains A) SGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALP GEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIA TKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQC RSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSV CCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSRLLSALNSHKDRFISGREIKK RKCLFGLHARMPPPVE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Polycomb-like proteins link the PRC2 complex to CpG islands. Li, H., Liefke, R., Jiang, J. et al. Nature (2017) 549:287-291. DOI 10.1038/nature23881 · PubMed
Other PDB entries of the same protein (UniProt O43189 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XFO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.