5XJD: TEAD

TEAD in complex with fragment. Determined by X-ray diffraction at 2.22 Å resolution. Released 24 Jan 2018.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,582
Mol. weight: 51.75 kDa
Ligands: 87L
Released: 24 Jan 2018

Explore 5XJD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XJD contains 18 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	213	1	1
β-strand	218-229	12	1
β-strand	235-244	10	1
α-helix	254-255	2
β-strand	256-259	4	2
α-helix	260-262	3
α-helix	264-266	3
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	2
β-strand	305-315	11	1
β-strand	321-329	9	2
β-strand	332-341	10	2
β-strand	344-346	3	1
β-strand	349-358	10	1
α-helix	359-360	2
α-helix	361-372	12
α-helix	376-383	8
β-strand	386-394	9	2
β-strand	400-410	11	2
α-helix	411-412	2
β-strand	418-425	8	2

Chain B: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	213	1	3
β-strand	218-229	12	3
β-strand	235-244	10	3
α-helix	254-255	2
β-strand	256-259	4	4
α-helix	260-262	3
α-helix	264-266	3
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	4
α-helix	302-304	3
β-strand	305-315	11	3
β-strand	321-329	9	4
β-strand	332-341	10	4
β-strand	344-346	3	3
β-strand	349-358	10	3
α-helix	359-360	2
α-helix	361-372	12
α-helix	376-383	8
β-strand	386-394	9	4
β-strand	400-410	11	4
β-strand	418-425	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional enhancer factor TEF-3	A, B	protein	220	Mus musculus	Q62296 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5XJD_1 Transcriptional enhancer factor TEF-3 (chains A, B)
SMRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKF
PEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKV
CSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFT
ILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Ligands and cofactors

ID	Name	Formula	Copies
87L	(2S)-2-phenyl-2-pyrrol-1-yl-ethanoic acid	C12 H11 N O2	1

Primary citation

Targeting YAP/TAZ-TEAD protein-protein interactions using fragment-based and computational modeling approaches. Kaan, H.Y.K., Sim, A.Y.L., Tan, S.K.J. et al. PLoS One (2017) 12:e0178381-e0178381. DOI 10.1371/journal.pone.0178381 · PubMed

Other PDB entries of the same protein (UniProt Q62296 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SBA 1.3 Å, Crystal Structure of mTEAD with a VGL4 Tertiary Structure Mimetic
6L9F 2.56 Å, Crystal structure of TEAD4 in complex with a novel FAM181A peptide
5Z2Q 2.74 Å, Vgll1-TEAD4 core complex
4LN0 2.9 Å, Crystal structure of the VGLL4-TEAD4 complex
5GN0 2.9 Å, Structure of TAZ-TEAD complex
3JUA 3.0 Å, Structural basis of YAP recognition by TEAD4 in the Hippo pathway

Browse structure collections

About this viewer

MolViewer shows 5XJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.