6SBA: MTEAD with a VGL4 Tertiary Structure Mimetic

Crystal Structure of mTEAD with a VGL4 Tertiary Structure Mimetic. Determined by X-ray diffraction at 1.3 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,207
Mol. weight: 28.71 kDa
Ligands: ACE
Released: 30 Sept 2020

Explore 6SBA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SBA contains 10 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	212-213	2	1
β-strand	218-228	11	1
β-strand	238-243	6	1
β-strand	244	1	2
β-strand	247	1	2
β-strand	257-259	3	3
α-helix	260-262	3
α-helix	264-266	3
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	3
α-helix	299-302	4
β-strand	305-315	11	1
β-strand	320-329	10	3
β-strand	332-342	11	3
β-strand	344-346	3	1
β-strand	349-358	10	1
α-helix	359-360	2
α-helix	361-371	11
α-helix	376-384	9
β-strand	386-394	9	3
β-strand	400-410	11	3
α-helix	411-412	2
β-strand	418-425	8	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-26	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional enhancer factor TEF-3	A	protein	221	Mus musculus	Q62296 (AlphaFold model)
Vestigial like 4 (Drosophila), isoform CRA_a	B	protein	20	Mus musculus	Q80V24 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SBA_1 Transcriptional enhancer factor TEF-3 (chains A)
GPGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDK
FPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTK
VCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENF
TILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Sequence of entity 2 (B), FASTA

>6SBA_2 Vestigial like 4 (Drosophila), isoform CRA_a (chains B)
SVEDHFAKALGDTWLQIKAA

Ligands and cofactors

ID	Name	Formula	Copies
ACE	Acetyl group	C2 H4 O	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

A protein tertiary structure mimetic modulator of the Hippo signalling pathway. Adihou, H., Gopalakrishnan, R., Forster, T. et al. Nat Commun (2020) 11:5425-5425. DOI 10.1038/s41467-020-19224-8 · PubMed

Other PDB entries of the same protein (UniProt Q62296 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XJD 2.22 Å, TEAD in complex with fragment
6L9F 2.56 Å, Crystal structure of TEAD4 in complex with a novel FAM181A peptide
5Z2Q 2.74 Å, Vgll1-TEAD4 core complex
4LN0 2.9 Å, Crystal structure of the VGLL4-TEAD4 complex
5GN0 2.9 Å, Structure of TAZ-TEAD complex
3JUA 3.0 Å, Structural basis of YAP recognition by TEAD4 in the Hippo pathway

Browse structure collections

About this viewer

MolViewer shows 6SBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.