Crystal Structure of PAK4 in complex with inhibitor CZH226. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Feb 2018.
Explore 5XVG in 3D Show helices and sheets RCSB PDB PDBe
5XVG contains 23 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 300-311 | 12 | |
| α-helix | 313 | 1 | |
| α-helix | 317-319 | 3 | |
| β-strand | 321-329 | 9 | 1 |
| β-strand | 334-340 | 7 | 1 |
| β-strand | 346-353 | 8 | 1 |
| α-helix | 354-356 | 3 | |
| α-helix | 361-369 | 9 | |
| β-strand | 378 | 1 | 2 |
| α-helix | 379-380 | 2 | |
| β-strand | 381-387 | 7 | 1 |
| β-strand | 390-395 | 6 | 1 |
| α-helix | 396-398 | 3 | |
| β-strand | 401-402 | 2 | 2 |
| α-helix | 403-409 | 7 | |
| β-strand | 410 | 1 | 3 |
| α-helix | 414-433 | 20 | |
| β-strand | 436-437 | 2 | 4 |
| α-helix | 443-445 | 3 | |
| β-strand | 446-448 | 3 | 2 |
| β-strand | 454-456 | 3 | 2 |
| β-strand | 463-464 | 2 | 4 |
| β-strand | 472 | 1 | 5 |
| α-helix | 479-481 | 3 | |
| α-helix | 484-487 | 4 | |
| β-strand | 492 | 1 | 5 |
| α-helix | 495-510 | 16 | |
| α-helix | 520-529 | 10 | |
| α-helix | 532-533 | 2 | |
| α-helix | 538-540 | 3 | |
| α-helix | 543-552 | 10 | |
| α-helix | 561-562 | 2 | |
| α-helix | 563-566 | 4 | |
| α-helix | 570-574 | 5 | |
| α-helix | 575-577 | 3 | |
| α-helix | 578-581 | 4 | |
| α-helix | 582-585 | 4 | |
| β-strand | 589 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PAK 4 | A | protein | 293 | Homo sapiens | O96013 (AlphaFold model) |
>5XVG_1 Serine/threonine-protein kinase PAK 4 (chains A) SSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ RRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA AVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT PYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL HKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 8FX | [6-chloranyl-4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl]-[(3R)-3-m… | C20 H22 Cl N7 O | 1 |
| EOH | Ethanol | C2 H6 O | 5 |
Water and common crystallization additives (EDO) are not listed.
Structure-Based Design of 6-Chloro-4-aminoquinazoline-2-carboxamide Derivatives as Potent and Selective p21-Activated Kinase 4 (PAK4) Inhibitors. Hao, C., Zhao, F., Song, H. et al. J Med Chem (2018) 61:265-285. DOI 10.1021/acs.jmedchem.7b01342 · PubMed
Other PDB entries of the same protein (UniProt O96013 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.