5XWS: SALM5 LRR-Ig

Crystal structure of SALM5 LRR-Ig. Determined by X-ray diffraction at 3.08 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 3.08 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,181
Mol. weight: 41.81 kDa
Released: 6 Jun 2018

Explore 5XWS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XWS contains 5 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	1
β-strand	32-36	5	1
β-strand	55-57	3	1
β-strand	65-66	2	2
α-helix	68-71	4
β-strand	79-81	3	1
β-strand	89-90	2	2
β-strand	103-105	3	1
β-strand	113-114	2	3
β-strand	127-129	3	1
β-strand	137-138	2	3
β-strand	151-153	3	1
α-helix	164-167	4
β-strand	175-177	3	1
β-strand	199-201	3	1
α-helix	214-217	4
β-strand	234-236	3	1
β-strand	242-243	2	4
α-helix	249-252	4
β-strand	262	1	5
β-strand	263-265	3	4
β-strand	273	1	5
α-helix	279-281	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat and fibronectin type-III domain-containing protein 5	A	protein	367	Homo sapiens	Q96NI6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XWS_1 Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (chains A)
QICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKDFANMTSL
VDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTL
ISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKM
TRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSRE
DDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPA
IHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIASNPAGEATQIVDLHIIKL
PHHHHHH

Primary citation

Structural basis of trans-synaptic interactions between PTP delta and SALMs for inducing synapse formation. Goto-Ito, S., Yamagata, A., Sato, Y. et al. Nat Commun (2018) 9:269-269. DOI 10.1038/s41467-017-02417-z · PubMed

Other PDB entries of the same protein (UniProt Q96NI6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XNQ 2.8 Å, Crystal structures of human SALM5
5XNP 3.73 Å, Crystal structures of human SALM5 in complex with human PTPdelta
5XWT 4.18 Å, Crystal structure of PTPdelta Ig1-Fn1 in complex with SALM5 LRR-Ig

Browse structure collections

About this viewer

MolViewer shows 5XWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.