5XXQ: RBBP4: ZNF827 and its function in telomere

Crystal structure of RBBP4: ZNF827 and its function in telomere. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,602
Mol. weight: 106.28 kDa
Released: 8 Aug 2018

Explore 5XXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XXQ contains 11 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	9-31	23
β-strand	32-39	8	1
β-strand	47-54	8	2
β-strand	61-69	9	2
β-strand	77-87	11	2
β-strand	115-123	9	2
β-strand	129-133	5	3
β-strand	136-143	8	3
β-strand	149-153	5	3
α-helix	154-156	3
β-strand	171-174	4	3
β-strand	180-185	6	4
β-strand	192-197	6	4
β-strand	202-206	5	4
β-strand	215-218	4	3
β-strand	221-223	3	4
β-strand	230-235	6	5
β-strand	242-247	6	5
β-strand	251-256	6	5
β-strand	267-270	4	5
β-strand	276-281	6	6
β-strand	288-293	6	6
β-strand	297-302	6	6
β-strand	311-314	4	6
β-strand	320-325	6	7
β-strand	332-337	6	7
β-strand	342-346	5	7
α-helix	347-349	3
α-helix	356-360	5
β-strand	366-370	5	7
β-strand	377-382	6	1
β-strand	389-394	6	1
β-strand	398-404	7	1

Chain B: 7 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	8-26	19
α-helix	28-31	4
β-strand	32-39	8	8
β-strand	47-49	3	9
β-strand	54	1	9
β-strand	61-69	9	9
β-strand	77-87	11	9
β-strand	114-123	10	9
β-strand	129-133	5	10
β-strand	136-143	8	10
β-strand	149-153	5	10
α-helix	154-156	3
α-helix	161-162	2
β-strand	171-174	4	10
β-strand	183-185	3	11
β-strand	192-196	5	11
β-strand	202-206	5	11
β-strand	212	1	10
β-strand	216-218	3	10
β-strand	221-223	3	11
β-strand	230-235	6	12
β-strand	242-247	6	12
β-strand	251-256	6	12
β-strand	267-270	4	12
β-strand	276-281	6	13
β-strand	288-293	6	13
β-strand	297-302	6	13
α-helix	303-305	3
β-strand	311-314	4	13
β-strand	320-325	6	14
β-strand	332-337	6	14
β-strand	342-346	5	14
α-helix	347-349	3
β-strand	366-370	5	14
β-strand	377-382	6	8
β-strand	389-394	6	8
β-strand	398-404	7	8
α-helix	406-409	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-binding protein RBBP4	A, B	protein	456	Homo sapiens	Q09028 (AlphaFold model)
Zinc finger protein 827	C, D	protein	14	Homo sapiens	Q17R98 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5XXQ_1 Histone-binding protein RBBP4 (chains A, B)
MSYYHHHHHHDYDIPTTENLYFQGAMGSGIQMADKEAAFDDAVEERVINEEYKIWKKNTP
FLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
DAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDV
LVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISA
VPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSV
DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHN
ETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWV
ICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Sequence of entity 2 (C, D), FASTA

>5XXQ_2 Zinc finger protein 827 (chains C, D)
MPRRKQEQPKRLPS

Primary citation

Crystal structure of RBBP4: ZNF827 and its function in telomere. Sun, A., Shi, Y. To be published.

Other PDB entries of the same protein (UniProt Q09028 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R7A 1.85 Å, Crystal Structure of RBBP4 bound to PHF6 peptide
7M40 1.88 Å, Discovery of small molecule antagonists of human Retinoblastoma Binding Protein 4 (RBBP4)
2XU7 1.9 Å, Structural basis for RbAp48 binding to FOG-1
6BW4 2.0 Å, Crystal structure of RBBP4 in complex with PRDM16 N-terminal peptide
9V5M 2.1 Å, The crystal structure of RBBP4-H3 complex
5Y1U 2.14 Å, Crystal structure of RBBP4 bound to AEBP2 RRK motif
4PBZ 2.15 Å, Structure of the human RbAp48-MTA1(670-695) complex
6BW3 2.2 Å, Crystal structure of RBBP4 in complex with PRDM3 N-terminal peptide
8TX8 2.2 Å, Crystal Structure of RBBP4 bound to ZNF512B peptide
3GFC 2.3 Å, Crystal Structure of Histone-binding protein RBBP4
5VTB 2.4 Å, Crystal structure of RBBP4 bound to BCL11a peptide
4PBY 2.5 Å, Structure of the human RbAp48-MTA1(656-686) complex

Browse structure collections

About this viewer

MolViewer shows 5XXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.