5XYF: Human TIN2-TPP1-TRF2 telomeric complex

Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Dec 2017.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,908
Mol. weight: 29.83 kDa
Released: 13 Dec 2017

Explore 5XYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XYF contains 14 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	8-24	17
α-helix	28-30	3
α-helix	31-44	14
α-helix	51-71	21
α-helix	76-86	11
α-helix	101-122	22
α-helix	128-138	11
α-helix	141-160	20
α-helix	169-177	9
α-helix	184-186	3
α-helix	187-195	9

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	511-516	6
α-helix	522-532	11

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	359-364	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TERF1-interacting nuclear factor 2	A	protein	204	Homo sapiens	Q9BSI4 (AlphaFold model)
Telomeric repeat-binding factor 2	C	protein	18	Homo sapiens	Q15554 (AlphaFold model)
Adrenocortical dysplasia protein homolog	B	protein	40	Homo sapiens	Q96AP0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XYF_1 TERF1-interacting nuclear factor 2 (chains A)
GGSATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLC
MGLKAKVVVELILQGRPWAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQV
KQLSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQLEKALPTPQAQQLQDVLSWMQ
PGVSITSSLAWRQYGVDMGWLLPE

Sequence of entity 2 (C), FASTA

>5XYF_2 Telomeric repeat-binding factor 2 (chains C)
SLQPKNKRMTISRLVLEE

Sequence of entity 3 (B), FASTA

>5XYF_3 Adrenocortical dysplasia protein homolog (chains B)
ADPRSSLCARVQAARLPPQLMAWALHFLMDAQPGSEPTPM

Primary citation

Structural and functional analyses of the mammalian TIN2-TPP1-TRF2 telomeric complex. Hu, C., Rai, R., Huang, C. et al. Cell Res (2017) 27:1485-1502. DOI 10.1038/cr.2017.144 · PubMed

Other PDB entries of the same protein (UniProt Q9BSI4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQO 2.0 Å, Crystal Structure of TRF1 TRFH domain and TIN2 peptide complex
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex

Browse structure collections

About this viewer

MolViewer shows 5XYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.