5Y6O: DAXX N-terminal four-helix bundle domain

Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX. Determined by X-ray diffraction at 3.1 Å resolution. Released 25 Oct 2017.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 9
Atoms: 7,467
Mol. weight: 123.18 kDa
Released: 25 Oct 2017

Explore 5Y6O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y6O contains 61 α-helices and 2 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	84-94	11
α-helix	97-100	4
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-135	13
α-helix	148-162	15

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60-77	18
α-helix	84-93	10
β-strand	95	1	1
α-helix	99-101	3
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-136	14
β-strand	138	1	1
α-helix	147-162	16

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	78-80	3
α-helix	84-93	10
α-helix	103-118	16
α-helix	123-135	13
α-helix	147-161	15

Chain D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	84-93	10
α-helix	97-100	4
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-134	12
α-helix	147-162	16

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	84-93	10
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-136	14
α-helix	148-162	15

Chain F: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	84-93	10
α-helix	99-101	3
α-helix	104-118	15
α-helix	120-122	3
α-helix	123-136	14
α-helix	147-161	15

Chain G: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	60-71	12
α-helix	84-93	10
α-helix	97-101	5
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-136	14
α-helix	147-162	16

Chain H: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	78-80	3
α-helix	84-93	10
α-helix	99-101	3
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-136	14
α-helix	147-162	16

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death domain-associated protein 6,Transcriptional regulator ATRX	A, B, C, D, E, F, G, H, I	protein	119	Homo sapiens	P46100 (AlphaFold model), Q9UER7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>5Y6O_1 Death domain-associated protein 6,Transcriptional regulator ATRX (chains A, B, C, D, E, F, G, H, I)
SSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNIL
SRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNNDPENRIAKKMLLEEIKANLSSDE

Primary citation

Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX. Huang, H., Patel, D.J. Nat Commun (2017).

Other PDB entries of the same protein (UniProt P46100 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QL9 0.93 Å, Monoclinic complex structure of ATRX ADD bound to histone H3K9me3 peptide
6G0O 1.4 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
5GRQ 1.58 Å, Crystal Structure of DHB domain of Daxx in complex with an ATRX peptide
3QLA 1.6 Å, Hexagonal complex structure of ATRX ADD bound to H3K9me3 peptide
3QLN 1.9 Å, Crystal structure of ATRX ADD domain in free state
5Y18 2.2 Å, Crystal structure of DAXX helical bundle domain in complex with ATRX
3QLC 2.5 Å, Complex structure of ATRX ADD domain bound to unmodified H3 1-15 peptide
4W5A 2.6 Å, Complex structure of ATRX ADD bound to H3K9me3S10ph peptide
9L06 3.4 Å, The cryo-EM structure of ATRX in complex with the nucleosome in the ADP.BeFx-bound state…
2JM1 Structures and chemical shift assignments for the ADD domain of the ATRX protein
2LBM Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3
2LD1 Structures and chemical shift assignments for the ADD domain of the ATRX protein

Browse structure collections

About this viewer

MolViewer shows 5Y6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.