5YBX: N-terminal domain of Bqt4 in S.pombe

Crystal structure of the N-terminal domain of Bqt4 in S.pombe. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Sept 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 1
Atoms: 1,021
Mol. weight: 16.19 kDa
Released: 19 Sept 2018

Explore 5YBX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YBX contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	26-28	3
β-strand	32-39	8	1
β-strand	42-52	11	1
β-strand	59-65	7	1
β-strand	71-72	2	1
α-helix	73-80	8
α-helix	86-99	14
β-strand	112-113	2	1
α-helix	115-124	10
α-helix	128-136	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bouquet formation protein 4	A	protein	142	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O60158 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YBX_1 Bouquet formation protein 4 (chains A)
GSTTENEKSRSLPAERNPLYKDDTLDHTPLIPKCRAQVIEFPDGPATFVRLKCTNPESKV
PHFLMRMAKDSSISATSMFRSAFPKATQEEEDLEMRWIRDNLNPIEDKRVAGLWVPPADA
LALAKDYSMTPFINALLEASST

Primary citation

The Inner Nuclear Membrane Protein Bqt4 in Fission Yeast Contains a DNA-Binding Domain Essential for Telomere Association with the Nuclear Envelope. Hu, C., Inoue, H., Sun, W. et al. Structure (2019) 27:335. DOI 10.1016/j.str.2018.10.010 · PubMed

Other PDB entries of the same protein (UniProt O60158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCA 1.57 Å, Crystal structure of inner membrane protein Bqt4 in complex with LEM2
6A6W 2.6 Å, Crystal structure of fission yeast inner membrane protein Bqt4 in complex with Sad1
5YC2 2.7 Å, Crystal structure of inner membrane protein Bqt4 in complex with telomeric protein Rap1

Browse structure collections

About this viewer

MolViewer shows 5YBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.