6A6W: Fission yeast inner membrane protein Bqt4

Name: PDB 6A6W: Crystal structure of fission yeast inner membrane protein Bqt4 in complex with Sad1
Published: 2018-11-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of fission yeast inner membrane protein Bqt4 in complex with Sad1. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Nov 2018.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 2
Atoms: 1,210
Mol. weight: 17.69 kDa
Released: 14 Nov 2018

Explore 6A6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A6W contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	26-31	6
β-strand	33-39	7	1
β-strand	42-52	11	1
β-strand	59-65	7	1
β-strand	71-72	2	1
α-helix	73-80	8
α-helix	86-99	14
β-strand	103	1	1
β-strand	112-113	2	1
α-helix	115-125	11
α-helix	128-136	9

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	86-89	4
α-helix	90-99	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bouquet formation protein 4	A	protein	140	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O60158 (AlphaFold model)
Spindle pole body-associated protein sad1	B	protein	17	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	Q09825 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6A6W_1 Bouquet formation protein 4 (chains A)
STENEKSRSLPAERNPLYKDDTLDHTPLIPKCRAQVIEFPDGPATFVRLKCTNPESKVPH
FLMRMAKDSSISATSMFRSAFPKATQEEEDLEMRWIRDNLNPIEDKRVAGLWVPPADALA
LAKDYSMTPFINALLEASST

Sequence of entity 2 (B), FASTA

>6A6W_2 Spindle pole body-associated protein sad1 (chains B)
GPLSDNEEFENVVKNGH

Primary citation

Structural insights into chromosome attachment to the nuclear envelope by an inner nuclear membrane protein Bqt4 in fission yeast. Hu, C., Inoue, H., Sun, W. et al. Nucleic Acids Res (2019) 47:1573-1584. DOI 10.1093/nar/gky1186 · PubMed

Other PDB entries of the same protein (UniProt O60158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCA 1.57 Å, Crystal structure of inner membrane protein Bqt4 in complex with LEM2
5YBX 2.5 Å, Crystal structure of the N-terminal domain of Bqt4 in S.pombe
5YC2 2.7 Å, Crystal structure of inner membrane protein Bqt4 in complex with telomeric protein Rap1

Browse structure collections

About this viewer

MolViewer shows 6A6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.