Crystal structure of the N-terminal domain of Bqt4 in S.pombe. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Sept 2018.
Explore 5YBX in 3D Show helices and sheets RCSB PDB PDBe
5YBX contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-18 | 3 | |
| α-helix | 26-28 | 3 | |
| β-strand | 32-39 | 8 | 1 |
| β-strand | 42-52 | 11 | 1 |
| β-strand | 59-65 | 7 | 1 |
| β-strand | 71-72 | 2 | 1 |
| α-helix | 73-80 | 8 | |
| α-helix | 86-99 | 14 | |
| β-strand | 112-113 | 2 | 1 |
| α-helix | 115-124 | 10 | |
| α-helix | 128-136 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bouquet formation protein 4 | A | protein | 142 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O60158 (AlphaFold model) |
>5YBX_1 Bouquet formation protein 4 (chains A) GSTTENEKSRSLPAERNPLYKDDTLDHTPLIPKCRAQVIEFPDGPATFVRLKCTNPESKV PHFLMRMAKDSSISATSMFRSAFPKATQEEEDLEMRWIRDNLNPIEDKRVAGLWVPPADA LALAKDYSMTPFINALLEASST
The Inner Nuclear Membrane Protein Bqt4 in Fission Yeast Contains a DNA-Binding Domain Essential for Telomere Association with the Nuclear Envelope. Hu, C., Inoue, H., Sun, W. et al. Structure (2019) 27:335. DOI 10.1016/j.str.2018.10.010 · PubMed
Other PDB entries of the same protein (UniProt O60158 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.