5YI4: DISC1/Ndel1 complex

Solution Structure of the DISC1/Ndel1 complex. Determined by solution NMR. Released 15 Nov 2017.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,084
Mol. weight: 15.46 kDa
Released: 15 Nov 2017

Explore 5YI4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YI4 contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-40	28
α-helix	46-69	24
β-strand	89	1	1
β-strand	96	1	1
α-helix	109-142	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disrupted in schizophrenia 1 homolog,Nuclear distribution protein nudE-like 1	A	protein	145	Mus musculus	Q811T9 (AlphaFold model), Q9ERR1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YI4_1 Disrupted in schizophrenia 1 homolog,Nuclear distribution protein nudE-like 1 (chains A)
GSEFGPWKEDSHIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALFQSLQGELQTVKE
TLQAMILQLQPTKEAGEASASYPTAGAQETEALVPRGSGFGTSPLTPSARISALNIVGDL
LRKVGALESKLAACRNFAKDQASRK

Primary citation

DISC1 Regulates Neurogenesis via Modulating Kinetochore Attachment of Ndel1/Nde1 during Mitosis. Ye, F., Kang, E., Yu, C. et al. Neuron (2017) 96:1041-1054.e5. DOI 10.1016/j.neuron.2017.10.010 · PubMed

Other PDB entries of the same protein (UniProt Q811T9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RUX 3.9 Å, Cryo-EM structure of DISC1 core
6IRR Solution structure of DISC1/ATF4 complex

Browse structure collections

About this viewer

MolViewer shows 5YI4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.