5YK5: Human Lamtor4-Lamtor5 complex

structure of the human Lamtor4-Lamtor5 complex. Determined by X-ray diffraction at 2.03 Å resolution. Released 12 Dec 2018.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,610
Mol. weight: 36.73 kDa
Released: 12 Dec 2018

Explore 5YK5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YK5 contains 10 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	15-22	8	1
β-strand	25-31	7	1
α-helix	37-52	16
β-strand	65-69	5	1
β-strand	73-79	7	1
β-strand	83-90	8	1

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
β-strand	18-24	7	1
β-strand	33-35	3	1
α-helix	39-53	15
α-helix	62-63	2
β-strand	64-68	5	1
β-strand	72-78	7	1
β-strand	83-89	7	1

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	15-22	8	2
β-strand	25-31	7	2
α-helix	37-52	16
β-strand	65-69	5	2
β-strand	73-80	8	2
β-strand	83-90	8	2

Chain D: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9
β-strand	18-24	7	2
β-strand	33-35	3	2
α-helix	39-53	15
α-helix	63	1
β-strand	64-68	5	2
β-strand	73-78	6	2
β-strand	83-88	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ragulator complex protein LAMTOR4	A	protein	84	Homo sapiens	Q0VGL1 (AlphaFold model)
Ragulator complex protein LAMTOR5	B	protein	89	Homo sapiens	O43504 (AlphaFold model)
Ragulator complex protein LAMTOR4	C	protein	84	Homo sapiens	Q0VGL1 (AlphaFold model)
Ragulator complex protein LAMTOR5	D	protein	86	Homo sapiens	O43504 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YK5_1 Ragulator complex protein LAMTOR4 (chains A)
LERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSV
VFGEHTLLVTVSGQRVFVVKRQNR

Sequence of entity 2 (B), FASTA

>5YK5_2 Ragulator complex protein LAMTOR5 (chains B)
AATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTD
IPVVCLESDNGNIMIQKHDGITVAVHKMA

Sequence of entity 3 (C), FASTA

>5YK5_3 Ragulator complex protein LAMTOR4 (chains C)
LARIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSV
VFGEHTLLVTVSGQRVFVVKRQNA

Sequence of entity 4 (D), FASTA

>5YK5_4 Ragulator complex protein LAMTOR5 (chains D)
TLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIP
VVCLESDNGNIMIQKHDGITVAVHKM

Primary citation

Structural insight into the Ragulator complex which anchors mTORC1 to the lysosomal membrane. Mu, Z., Wang, L., Deng, W. et al. Cell Discov (2017) 3:17049-17049. DOI 10.1038/celldisc.2017.49 · PubMed

Other PDB entries of the same protein (UniProt Q0VGL1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B9X 1.42 Å, Crystal structure of Ragulator
5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
5X6U 2.4 Å, Crystal structure of human heteropentameric complex
5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
5Y38 2.8 Å, Crystal structure of C7orf59-HBXIP complex
5VOK 2.89 Å, Crystal structure of the C7orf59-HBXIP dimer
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
5YK3 3.01 Å, human Ragulator complex
6U62 3.18 Å, Raptor-Rag-Ragulator complex

Browse structure collections

About this viewer

MolViewer shows 5YK5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.