5Y38: C7orf59-HBXIP complex

Crystal structure of C7orf59-HBXIP complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,230
Mol. weight: 21.92 kDa
Released: 6 Dec 2017

Explore 5Y38 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y38 contains 3 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	90-95	6
β-strand	100-106	7	1
β-strand	112-117	6	1
α-helix	121-135	15
β-strand	146-150	5	1
β-strand	155-161	7	1
β-strand	164-170	7	1

Chain B: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
β-strand	25-31	7	1
α-helix	37-51	15
β-strand	65-69	5	1
β-strand	73-80	8	1
β-strand	83-90	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ragulator complex protein LAMTOR5	A	protein	91	Homo sapiens	O43504 (AlphaFold model)
Ragulator complex protein LAMTOR4	B	protein	109	Homo sapiens	Q0VGL1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Y38_1 Ragulator complex protein LAMTOR5 (chains A)
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Sequence of entity 2 (B), FASTA

>5Y38_2 Ragulator complex protein LAMTOR4 (chains B)
MGMTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRG
MNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDVLEHHHHHH

Primary citation

Structural basis for Ragulator functioning as a scaffold in membrane-anchoring of Rag GTPases and mTORC1. Zhang, T., Wang, R., Wang, Z. et al. Nat Commun (2017) 8:1394-1394. DOI 10.1038/s41467-017-01567-4 · PubMed

Other PDB entries of the same protein (UniProt O43504 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B9X 1.42 Å, Crystal structure of Ragulator
3MSH 1.51 Å, Crystal structure of Hepatitis B X-Interacting Protein at high resolution
5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
5YK5 2.03 Å, structure of the human Lamtor4-Lamtor5 complex
3MS6 2.08 Å, Crystal structure of Hepatitis B X-Interacting Protein (HBXIP)
6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
5X6U 2.4 Å, Crystal structure of human heteropentameric complex
5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
5VOK 2.89 Å, Crystal structure of the C7orf59-HBXIP dimer
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex

Browse structure collections

About this viewer

MolViewer shows 5Y38 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.