Crystal structure of kelch domain of KLHL20. Determined by X-ray diffraction at 1.58 Å resolution. Released 14 Nov 2018.
Explore 5YQ4 in 3D Show helices and sheets RCSB PDB PDBe
5YQ4 contains 6 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 319-327 | 9 | 1 |
| α-helix | 332 | 1 | |
| β-strand | 333-339 | 7 | 1 |
| β-strand | 344-347 | 4 | 1 |
| α-helix | 349-351 | 3 | |
| β-strand | 356 | 1 | 2 |
| β-strand | 359-363 | 5 | 3 |
| β-strand | 366-370 | 5 | 3 |
| β-strand | 373-374 | 2 | 2 |
| β-strand | 377-378 | 2 | 2 |
| β-strand | 382-386 | 5 | 3 |
| β-strand | 391-393 | 3 | 3 |
| α-helix | 397-399 | 3 | |
| β-strand | 404 | 1 | 4 |
| β-strand | 407-411 | 5 | 4 |
| β-strand | 414-421 | 8 | 4 |
| β-strand | 426-434 | 9 | 4 |
| β-strand | 439-442 | 4 | 4 |
| α-helix | 444-446 | 3 | |
| β-strand | 451 | 1 | 5 |
| β-strand | 454-458 | 5 | 6 |
| β-strand | 461-465 | 5 | 6 |
| β-strand | 468 | 1 | 5 |
| β-strand | 473 | 1 | 5 |
| β-strand | 477-481 | 5 | 6 |
| β-strand | 486-489 | 4 | 6 |
| α-helix | 491-493 | 3 | |
| β-strand | 498 | 1 | 7 |
| β-strand | 501-505 | 5 | 8 |
| β-strand | 508-512 | 5 | 8 |
| β-strand | 515 | 1 | 7 |
| β-strand | 520 | 1 | 7 |
| β-strand | 524-528 | 5 | 8 |
| β-strand | 533-537 | 5 | 8 |
| α-helix | 538-540 | 3 | |
| β-strand | 545 | 1 | 9 |
| β-strand | 548-552 | 5 | 10 |
| β-strand | 555-559 | 5 | 10 |
| β-strand | 562 | 1 | 9 |
| β-strand | 567 | 1 | 9 |
| β-strand | 570-575 | 6 | 10 |
| β-strand | 580-585 | 6 | 10 |
| β-strand | 594-599 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like protein 20 | A | protein | 299 | Homo sapiens | Q9Y2M5 (AlphaFold model) |
>5YQ4_1 Kelch-like protein 20 (chains A) SMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVS VLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQ DGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYN PQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMT SRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIK
The crystal structure of kelch domain of KLHL20. Yeh, M.C., Ho, M.C. To be published.
Other PDB entries of the same protein (UniProt Q9Y2M5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.