MAP2K7 C276S mutant-inhibitor. Determined by X-ray diffraction at 2.28 Å resolution. Released 2 Jan 2019.
Explore 5Z1D in 3D Show helices and sheets RCSB PDB PDBe
5Z1D contains 19 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 120-124 | 5 | 1 |
| β-strand | 127-131 | 5 | 1 |
| α-helix | 133-135 | 3 | |
| β-strand | 136-141 | 6 | 1 |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 161-168 | 8 | 1 |
| α-helix | 173-188 | 16 | |
| β-strand | 195 | 1 | 2 |
| β-strand | 198-203 | 6 | 1 |
| β-strand | 207-212 | 6 | 1 |
| β-strand | 217-218 | 2 | 2 |
| α-helix | 219-226 | 8 | |
| α-helix | 229-231 | 3 | |
| α-helix | 232-253 | 22 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265-267 | 3 | 2 |
| β-strand | 273-275 | 3 | 2 |
| α-helix | 297-299 | 3 | |
| α-helix | 302-305 | 4 | |
| α-helix | 319-333 | 15 | |
| α-helix | 344-353 | 10 | |
| α-helix | 355-356 | 2 | |
| α-helix | 358-360 | 3 | |
| α-helix | 361-363 | 3 | |
| α-helix | 367-376 | 10 | |
| α-helix | 381-383 | 3 | |
| α-helix | 385-386 | 2 | |
| α-helix | 387-390 | 4 | |
| α-helix | 394-401 | 8 | |
| α-helix | 406-416 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dual specificity mitogen-activated protein kinase kinase 7 | A | protein | 324 | Homo sapiens | O14733 (AlphaFold model) |
>5Z1D_1 Dual specificity mitogen-activated protein kinase kinase 7 (chains A) MTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENK RILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGK MTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLSDFGISGRLVDSKAKTRSAGCA AYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPP LLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKT ESPRTSGVLSQPHLPFFRHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 95U | N-[3-(6-methyl-1H-indazol-3-yl)phenyl]prop-2-enamide | C17 H15 N3 O | 1 |
Water and common crystallization additives (EPE) are not listed.
Covalent Docking Identifies a Potent and Selective MKK7 Inhibitor. Shraga, A., Olshvang, E., Davidzohn, N. et al. Cell Chem Biol (2019) 26:98-108.e5. DOI 10.1016/j.chembiol.2018.10.011 · PubMed
Other PDB entries of the same protein (UniProt O14733 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5Z1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.