5Z78: TIRR/53BP1 complex

Structure of TIRR/53BP1 complex. Determined by X-ray diffraction at 1.76 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 1.76 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 4,192
Mol. weight: 60.44 kDa
Released: 6 Jun 2018

Explore 5Z78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z78 contains 23 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-12	3	3
α-helix	14-18	5
β-strand	25-40	16	3
β-strand	44-55	12	3
β-strand	60-61	2	3
β-strand	64-67	4	3
α-helix	74-81	8
α-helix	93-95	3
β-strand	96-101	6	3
β-strand	108-117	10	3
α-helix	119-130	12
β-strand	135	1	3
β-strand	139-145	7	3
α-helix	146	1
β-strand	149	1	4
β-strand	156	1	4
α-helix	157-161	5
β-strand	165	1	3
α-helix	167-179	13
α-helix	185-202	18

Chain B: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	11-12	2	1
α-helix	14-19	6
β-strand	25-40	16	1
β-strand	44-55	12	1
β-strand	60-61	2	1
β-strand	64-67	4	1
α-helix	74-85	12
α-helix	93-95	3
β-strand	96-101	6	1
α-helix	102	1
β-strand	108-117	10	1
α-helix	119-130	12
β-strand	135	1	1
β-strand	139-145	7	1
α-helix	146	1
β-strand	149	1	2
β-strand	156	1	2
α-helix	157-161	5
β-strand	165	1	1
α-helix	167-179	13
α-helix	185-202	18

Chain C: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	1490-1494	5	5
β-strand	1501-1511	11	5
β-strand	1514-1519	6	5
β-strand	1524-1528	5	5
α-helix	1529-1531	3
β-strand	1532-1533	2	5
α-helix	1538-1539	2
β-strand	1543-1547	5	6
β-strand	1553-1557	5	6
β-strand	1561-1564	4	7
β-strand	1567-1570	4	7
β-strand	1581-1582	2	7
α-helix	1583-1585	3
β-strand	1586-1587	2	6
β-strand	1588	1	5
α-helix	1590-1594	5
β-strand	1601	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tudor-interacting repair regulator protein	A, B	protein	209	Mus musculus	Q8VHN8 (AlphaFold model)
TP53-binding protein 1	C	protein	123	Homo sapiens	Q12888 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5Z78_1 Tudor-interacting repair regulator protein (chains A, B)
GHMVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGF
PGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQL
HAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVLNM
MPSEKLAEALASATEKQKKALEKLLPPSS

Sequence of entity 2 (C), FASTA

>5Z78_2 TP53-binding protein 1 (chains C)
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPL
DTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQY
GLG

Primary citation

Structural basis for recognition of 53BP1 tandem Tudor domain by TIRR. Dai, Y., Zhang, A., Shan, S. et al. Nat Commun (2018) 9:2123-2123. DOI 10.1038/s41467-018-04557-2 · PubMed

Other PDB entries of the same protein (UniProt Q8VHN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZG0 2.01 Å, Crystal structure of Mouse Syndesmos protein

Browse structure collections

About this viewer

MolViewer shows 5Z78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.