5Z8I: SBDbeta domain of yeast Ssa1

Solution structure of the SBDbeta domain of yeast Ssa1. Determined by solution NMR. Released 26 Sept 2018.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 1,317
Mol. weight: 18.77 kDa
Released: 26 Sept 2018

Explore 5Z8I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z8I contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
β-strand	17-21	5	2
β-strand	25-30	6	2
α-helix	34	1
β-strand	35	1	1
β-strand	38-44	7	3
β-strand	45-46	2	4
β-strand	53-60	8	2
β-strand	65	1	2
α-helix	66-68	3
β-strand	70-78	9	2
β-strand	90-96	7	3
β-strand	101-108	8	3
β-strand	114-120	7	3
α-helix	128-140	13
α-helix	142-152	11
β-strand	157-158	2	4
β-strand	159	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein SSA1	A	protein	173	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P10591 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Z8I_1 Heat shock protein SSA1 (chains A)
SSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFE
GERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITIT
NDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAG

Primary citation

The C-terminal GGAP motif of Hsp70 mediates substrate recognition and stress response in yeast. Gong, W., Hu, W., Xu, L. et al. J Biol Chem (2018) 293:17663-17675. DOI 10.1074/jbc.RA118.002691 · PubMed

Other PDB entries of the same protein (UniProt P10591 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LYN 2.0 Å, Structure of the Tpr Domain of Sgt2 in complex with yeast Ssa1 peptide fragment
3LCA 2.19 Å, Structure of Tom71 complexed with Hsp70 Ssa1 C terminal tail indicating conformational…
5Z8Q Solution structure of the SBDalpha domain of yeast Ssa1

Browse structure collections

About this viewer

MolViewer shows 5Z8I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.