5ZB2: Rad7 and Elc1 complex in yeast

Crystal structure of Rad7 and Elc1 complex in yeast. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 Feb 2019.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 4,171
Mol. weight: 59.27 kDa
Ligands: 9FO, P33, PG0
Released: 27 Feb 2019

Explore 5ZB2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZB2 contains 27 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	168-201	34
α-helix	207-209	3
α-helix	210-219	10
β-strand	224	1	1
α-helix	227-231	5
β-strand	238-241	4	2
β-strand	246	1	1
α-helix	249-258	10
β-strand	264-268	5	2
α-helix	275-284	10
β-strand	290-294	5	2
α-helix	301-310	10
β-strand	317-321	5	2
α-helix	328-338	11
α-helix	339-341	3
β-strand	344-348	5	2
α-helix	356-358	3
α-helix	359-362	4
β-strand	370-374	5	2
α-helix	379-381	3
α-helix	384-394	11
α-helix	395-397	3
β-strand	400-404	5	2
α-helix	411-412	2
α-helix	413-418	6
α-helix	419-421	3
β-strand	425	1	3
β-strand	430-432	3	2
α-helix	441-450	10
β-strand	452	1	3
β-strand	458-460	3	2
α-helix	469-477	9
α-helix	480-482	3
β-strand	486-488	3	2
α-helix	497-501	5
β-strand	510-512	3	2
α-helix	521-530	10
β-strand	536-538	3	2
β-strand	556-558	3	2
α-helix	561-563	3

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	4
β-strand	15-19	5	4
α-helix	20-23	4
β-strand	33-35	3	4
α-helix	41-57	17
α-helix	74-76	3
α-helix	77-87	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein RAD7	A	protein	405	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P06779 (AlphaFold model)
Elongin-C	B	protein	103	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q03071 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5ZB2_1 DNA repair protein RAD7 (chains A)
MARSVSSLQSLCITKISENISKWQKEADESSKLVFNKLRDVLGGVSTANLNNLAKALSKN
RALNDHTLQLFLKTDLKRLTFSDCSKISFDGYKTLAIFSPHLTELSLQMCGQLNHESLLY
IAEKLPNLKSLNLDGPFLINEDTWEKFFVIMKGRLEEFHISNTHRFTDKSLSNLLINCGS
TLVSLGLSRLDSISNYALLPQYLVNDEFHSLCIEYPFNEEDVNDEIIINLLGQIGRTLRK
LVLNGCIDLTDSMIINGLTAFIPEKCPLEVLSLEESDQITTDSLSYFFSKVELNNLIECS
FRRCLQLGDMAIIELLLNGARDSLRSLNLNSLKELTKEAFVALACPNLTYLDLGFVRCVD
DSVIQMLGEQNPNLTVIDVFGDNLVTEKATMRPGLTLIGRQSDSI

Sequence of entity 2 (B), FASTA

>5ZB2_2 Elongin-C (chains B)
MGSSHHHHHHSQGSMSQDFVTLVSKDDKEYEISRSAAMISPTLKAGRIELKQFDSHILEK
AVEYLNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI

Ligands and cofactors

ID	Name	Formula	Copies
9FO	3,6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51,54,57-nonadecaoxanonapentaconta…	C40 H82 O21	1
P33	3,6,9,12,15,18-hexaoxaicosane-1,20-diol	C14 H30 O8	1
PG0	2-(2-methoxyethoxy)ethanol	C5 H12 O3	1

Water and common crystallization additives (NA, P6G, GOL) are not listed.

Primary citation

Crystal structure of the yeast Rad7-Elc1 complex and assembly of the Rad7-Rad16-Elc1-Cul3 complex. Liu, L., Huo, Y., Li, J. et al. DNA Repair (Amst) (2019) 77:1-9. DOI 10.1016/j.dnarep.2019.02.012 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5ZB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.