5ZJW: PAK4

Crystal Structure of PAK4 in complex with inhibitor CZg353. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Apr 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,686
Mol. weight: 34.23 kDa
Ligands: BCT, 9EO
Released: 3 Apr 2019

Explore 5ZJW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZJW contains 21 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	301-311	11
α-helix	317-319	3
β-strand	321-329	9	1
β-strand	334-340	7	1
β-strand	346-353	8	1
α-helix	360-362	3
α-helix	363-369	7
β-strand	378	1	2
α-helix	379-380	2
β-strand	381-387	7	1
β-strand	390-396	7	1
β-strand	401-402	2	2
α-helix	403-409	7
α-helix	414-433	20
β-strand	436-437	2	3
α-helix	443-445	3
β-strand	446-448	3	2
β-strand	454-456	3	2
β-strand	463-464	2	3
β-strand	472	1	4
α-helix	479-481	3
α-helix	484-487	4
β-strand	492	1	4
α-helix	495-510	16
α-helix	520-529	10
α-helix	532-533	2
α-helix	538-540	3
α-helix	543-552	10
α-helix	561-562	2
α-helix	563-566	4
α-helix	570-574	5
α-helix	575-577	3
α-helix	578-581	4
α-helix	583-586	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase PAK 4	A	protein	293	Homo sapiens	O96013 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5ZJW_1 Serine/threonine-protein kinase PAK 4 (chains A)
SSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR

Ligands and cofactors

ID	Name	Formula	Copies
BCT	Bicarbonate ion	C H O3	1
9EO	(3Z)-N-[(1S)-2-hydroxy-1-phenylethyl]-3-[(1H-imidazol-2-yl)(phenyl)methylidene]…	C27 H22 N4 O3	1

Water and common crystallization additives (TRS, EDO) are not listed.

Primary citation

Crystal Structure of PAK4 in complex with inhibitor CZg353. Zhao, F., Li, H. To be published.

Other PDB entries of the same protein (UniProt O96013 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J0I 1.6 Å, Crystal structure of the human P21-activated kinase 4
2Q0N 1.75 Å, Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide
5VEF 1.75 Å, PAK4 kinase domain in complex with fasudil
5XVA 1.85 Å, Crystal Structure of PAK4 in complex with inhibitor CZH216
4JDI 1.85 Å, Crystal structure of Serine/threonine-protein kinase PAK 4 in complex with Paktide S…
8AHG 1.89 Å, PAC-FragmentDEL: Photoactivated covalent capture of DNA encoded fragments for hit…
6WLY 1.9 Å, PAK4 kinase domain in complex with LIMK1 Thr508 substrate peptide
7S48 1.9 Å, PAK4cat in complex with Integrin beta5 760-770 peptide
4FIH 1.97 Å, Catalytic domain of human PAK4 with QKFTGLPRQW peptide
4FII 2.0 Å, Catalytic domain of human PAK4 with RPKPLVDP peptide
4JDH 2.0 Å, Crystal structure of Serine/threonine-protein kinase PAK 4 in complex with Paktide T…
7S47 2.0 Å, Integrin beta5(743-774)-linker-PAK4cat(D440N/S474E)

Browse structure collections

About this viewer

MolViewer shows 5ZJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.