5ZZ3: Intracellular B30.2 domain of BTN3A3

Crystal structure of intracellular B30.2 domain of BTN3A3. Determined by X-ray diffraction at 3.0 Å resolution. Released 3 Apr 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,560
Mol. weight: 32.56 kDa
Released: 3 Apr 2019

Explore 5ZZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZZ3 contains 5 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	299-306	8
β-strand	308-309	2	1
α-helix	310	1
β-strand	314-315	2	2
β-strand	323-325	3	1
β-strand	331-334	4	1
α-helix	338-340	3
β-strand	353-356	4	2
β-strand	360	1	2
β-strand	364-370	7	1
β-strand	377-383	7	2
α-helix	397-399	3
β-strand	401-407	7	2
β-strand	411-414	4	2
β-strand	420-421	2	2
β-strand	430-436	7	1
β-strand	441-446	6	1
β-strand	452-455	4	1
β-strand	465-470	6	2
β-strand	479-481	3	1
α-helix	482-484	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin, subfamily 3, member A3 isoform b variant	A	protein	290	Homo sapiens	O00478 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5ZZ3_1 Butyrophilin, subfamily 3, member A3 isoform b variant (chains A)
MGSSHHHHHHSSGLVPRGSHMENLYFQGAGAGAAYHEWKMALFKPADVILDPDTANAILL
VSEDQRSVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSK
NVERKKGWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISF
YNATDGSHIYTFPHASFSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLET
PLTPGLANESGEPQAEVTSLLLPAHPGAEVSPSATTNQNHKLQARTEALY

Primary citation

A Structural Change in Butyrophilin upon Phosphoantigen Binding Underlies Phosphoantigen-Mediated V gamma 9V delta 2 T Cell Activation. Yang, Y., Li, L., Yuan, L. et al. Immunity (2019) 50:1043. DOI 10.1016/j.immuni.2019.02.016 · PubMed

Other PDB entries of the same protein (UniProt O00478 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J0G 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
6J0L 1.95 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with sulfate…
6J0K 2.0 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
4F8T 2.38 Å, Crystal Structure of the Human BTN3A3 Ectodomain
9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
8ZJY 3.7 Å, Cryo-EM structure of pAg-bound BTN2A1-BTN3A1-BTN3A3 in complex with Vgamma9-Vdelta2 TCR…
8ZJZ 3.8 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A3 complex
8ZYR 4.07 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A3

Browse structure collections

About this viewer

MolViewer shows 5ZZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.