6A30: Protein unc-13 homolog A

Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region. Determined by X-ray diffraction at 2.79 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.79 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 4,347
Mol. weight: 62.73 kDa
Released: 30 Jan 2019

Explore 6A30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A30 contains 27 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	945-961	17
α-helix	964-967	4
α-helix	973-995	23
α-helix	1006-1026	21
α-helix	1028-1035	8
α-helix	1059-1077	19
α-helix	1092-1118	27
α-helix	1123-1136	14
α-helix	1137-1141	5
α-helix	1145-1148	4
α-helix	1154-1186	33
β-strand	1193	1	1
β-strand	1196	1	1
α-helix	1200-1218	19
α-helix	1224-1250	27
α-helix	1253-1256	4
α-helix	1263-1285	23
α-helix	1293-1319	27
α-helix	1322-1337	16
α-helix	1350-1352	3
α-helix	1353-1374	22
α-helix	1381-1400	20
α-helix	1405-1408	4
β-strand	1409-1410	2	2
β-strand	1417-1418	2	2
α-helix	1419-1421	3
α-helix	1423-1425	3
α-helix	1426-1444	19
α-helix	1452-1456	5
α-helix	1459-1471	13
α-helix	1476-1477	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-13 homolog A	A	protein	537	Rattus norvegicus	Q62768 (AlphaFold model)
Synaptobrevin-2 juxtamembrane linker peptide	P	protein	6	Rattus norvegicus	P63045 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6A30_1 Protein unc-13 homolog A (chains A)
ERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPP
RASQVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSK
LITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKS
ADYMNLHFKVKWLYNEYVAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALER
DKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLL
QYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQ
VKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQP
IMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHMVREEAKS
LTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIK

Sequence of entity 2 (P), FASTA

>6A30_2 Synaptobrevin-2 juxtamembrane linker peptide (chains P)
KYWWKN

Primary citation

Munc18 and Munc13 serve as a functional template to orchestrate neuronal SNARE complex assembly. Wang, S., Li, Y., Gong, J.H. et al. Nat Commun (2019) 10:69-69. DOI 10.1038/s41467-018-08028-6 · PubMed

Other PDB entries of the same protein (UniProt Q62768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NYT 1.37 Å, Munc13-1 C2B-domain, calcium bound
2CJT 1.44 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
2CJS 1.78 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
6NYC 1.89 Å, Munc13-1 C2B-domain, calcium free
3SWH 2.65 Å, Munc13-1, MUN domain, C-terminal module
5UF7 2.9 Å, Crystal structure of MUNC13-1 mun domain
4Y21 2.9 Å, Crystal Structure of Munc13-1 MUN domain
5UE8 3.35 Å, The crystal structure of Munc13-1 C1C2BMUN domain
7T7X 10.0 Å, Munc13-1 C1-C2B-MUN-C2C Upright conformation spanning two lipid bilayers
7T81 10.0 Å, Model of Munc13-1 C1-C2B-MUN-C2C 2D crystal between lipid bilayers.
1Y8F Solution structure of the munc13-1 C1-domain
2KDU Structural basis of the Munc13-1/Ca2+-Calmodulin interaction: A novel 1-26 calmodulin…

Browse structure collections

About this viewer

MolViewer shows 6A30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.