6A9X: AnkG/GABARAP Complex

Crystal Structure of AnkG/GABARAP Complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 Dec 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 2
Atoms: 1,102
Mol. weight: 16.64 kDa
Released: 26 Dec 2018

Explore 6A9X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A9X contains 6 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1990	1	1
α-helix	1994-2003	10

Chain D: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein	D	protein	117	Mus musculus	Q9DCD6 (AlphaFold model)
Ankyrin-3	A	protein	24	Rattus norvegicus	O70511 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6A9X_1 Gamma-aminobutyric acid receptor-associated protein (chains D)
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Sequence of entity 2 (A), FASTA

>6A9X_2 Ankyrin-3 (chains A)
DDWTEFSSEEIREARQAAASHAPS

Primary citation

Ankyrin-G regulates forebrain connectivity and network synchronization via interaction with GABARAP. Nelson, A.D., Caballero-Floran, R.N., Rodriguez Diaz, J.C. et al. Mol Psychiatry (2018). DOI 10.1038/s41380-018-0308-x · PubMed

Other PDB entries of the same protein (UniProt Q9DCD6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
7FB5 2.84 Å, Crystal structure of FAM134B/GABARAP complex

Browse structure collections

About this viewer

MolViewer shows 6A9X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.