6AAF: Fission yeast Atg8

Name: PDB 6AAF: Crystal structure of fission yeast Atg8 complexed with the helical AIM of Hfl1.
Published: 2018-12-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of fission yeast Atg8 complexed with the helical AIM of Hfl1. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Dec 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 2
Atoms: 1,089
Mol. weight: 17.74 kDa
Released: 12 Dec 2018

Explore 6AAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AAF contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	395-403	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 8	A	protein	119	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O94272 (AlphaFold model)
Transmembrane protein 184 homolog C30D11.06c	B	protein	31	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	Q09906 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AAF_1 Autophagy-related protein 8 (chains A)
GPHMRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTV
GQFVYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFG

Sequence of entity 2 (B), FASTA

>6AAF_2 Transmembrane protein 184 homolog C30D11.06c (chains B)
MLQFEIDDEMEPLYNQAKQMRYGDYLEVLFQ

Primary citation

Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein. Liu, X.M., Yamasaki, A., Du, X.M. et al. Elife (2018) 7. DOI 10.7554/eLife.41237 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6AAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.