6ADE: Glyceraldehyde-3-phosphate dehydrogenase

Crystal structure of phosphorylated mutant of glyceraldehyde 3-phosphate dehydrogenase from human placenta at 3.15A resolution. Determined by X-ray diffraction at 3.15 Å resolution. Released 22 Aug 2018.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,679
Mol. weight: 109.39 kDa
Ligands: NAD
Released: 22 Aug 2018

Explore 6ADE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ADE contains 44 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
α-helix	13-25	13
β-strand	29-34	6	1
α-helix	40-48	9
β-strand	60-63	4	2
β-strand	66-69	4	2
β-strand	72-74	3	2
β-strand	75-77	3	1
α-helix	82-84	3
α-helix	87-90	4
β-strand	94-97	4	1
α-helix	105-108	4
α-helix	110-113	4
β-strand	118-121	4	1
α-helix	129	1
β-strand	130	1	1
α-helix	137-139	3
β-strand	144	1	3
β-strand	146-148	3	1
α-helix	152-167	16
β-strand	170-179	10	4
β-strand	186	1	5
α-helix	197-199	3
β-strand	201	1	5
β-strand	207-209	3	4
α-helix	213-220	8
α-helix	222-224	3
β-strand	228-234	7	4
β-strand	241-249	9	4
α-helix	255-267	13
β-strand	274-277	4	4
α-helix	283-286	4
β-strand	293-304	12	4
β-strand	307-314	8	4
α-helix	318-333	16

Chain C: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	10
α-helix	13-25	13
β-strand	29-34	6	10
α-helix	40-48	9
β-strand	60-63	4	11
β-strand	66-69	4	11
β-strand	72-74	3	11
β-strand	75-77	3	10
α-helix	82-84	3
α-helix	87-90	4
β-strand	94-97	4	10
α-helix	105-108	4
α-helix	110-113	4
β-strand	118-121	4	10
α-helix	129	1
β-strand	130	1	10
α-helix	137-139	3
β-strand	146-148	3	10
α-helix	152-167	16
β-strand	170-179	10	12
β-strand	186	1	13
β-strand	201	1	13
β-strand	207-209	3	12
α-helix	213-220	8
α-helix	222-224	3
β-strand	228-234	7	12
β-strand	241-249	9	12
α-helix	255-267	13
β-strand	274-277	4	12
α-helix	283-286	4
β-strand	293-304	12	12
β-strand	307-314	8	12
α-helix	318-333	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glyceraldehyde-3-phosphate dehydrogenase	A, B, C	protein	335	Homo sapiens	P04406 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6ADE_1 Glyceraldehyde-3-phosphate dehydrogenase (chains A, B, C)
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLLGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Ligands and cofactors

ID	Name	Formula	Copies
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	1

Primary citation

Crystal structure of phosphorylated mutant of glyceraldehyde 3-phosphate dehydrogenase from human placenta at 3.15A resolution. Dilawari, R., Singh, P.K., Raje, M. et al. To be published.

Other PDB entries of the same protein (UniProt P04406 (AlphaFold model), which also has an AlphaFold model), best resolution first:

27FM 1.46 Å, Crystal structure of human glyceraldehyde-3-phosphate dehydrogenase bound to gold(I)
6YND 1.52 Å, GAPDH purified from the supernatant of HEK293F cells: crystal form 1 of 4.
1U8F 1.75 Å, Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75…
9L3E 1.77 Å, Structure of GAPDH complexed with Leu-F
8P5F 1.82 Å, Human wild-type GAPDH,orthorhombic form
6M61 1.82 Å, Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) with inhibitor heptelidic acid
6YNE 1.85 Å, GAPDH purified from the supernatant of HEK293F cells: crystal form 2 of 4.
9UNY 1.87 Å, Natural product inhibitor of glyceraldehyde-3-phosphate dehydrogenase(GAPDH)
8G17 1.98 Å, CryoEM structure of wild-type GAPDH
4WNC 1.99 Å, Crystal structure of human wild-type GAPDH at 1.99 angstroms resolution
8G15 2.07 Å, CryoEM structure of nuclear GAPDH under 24h Oxidative Stress
8G16 2.07 Å, CryoEM structure of cytoplasmic GAPDH under 24h Oxidative Stress

Browse structure collections

About this viewer

MolViewer shows 6ADE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.