Crystal Structure of the four Ig-like domain of LILRB2(LIR2/ILT4/CD85d). Determined by X-ray diffraction at 3.8 Å resolution. Released 31 Jul 2019.
Explore 6AED in 3D Show helices and sheets RCSB PDB PDBe
6AED contains 12 α-helices and 49 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-17 | 3 | 2 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 34-38 | 5 | 3 |
| α-helix | 49-51 | 3 | |
| β-strand | 55-56 | 2 | 1 |
| β-strand | 59-62 | 4 | 1 |
| β-strand | 71-73 | 3 | 4 |
| β-strand | 74-79 | 6 | 3 |
| β-strand | 82-84 | 2 | 3 |
| α-helix | 85-90 | 6 | |
| β-strand | 91-93 | 3 | 4 |
| β-strand | 94-96 | 3 | 2 |
| β-strand | 103-107 | 5 | 5 |
| α-helix | 116-117 | 2 | |
| β-strand | 118-128 | 11 | 5 |
| β-strand | 130-135 | 6 | 6 |
| β-strand | 144-146 | 3 | 6 |
| α-helix | 147-148 | 2 | |
| β-strand | 154-161 | 8 | 5 |
| β-strand | 171-178 | 8 | 6 |
| β-strand | 181-185 | 5 | 6 |
| α-helix | 187-190 | 4 | |
| β-strand | 192-193 | 2 | 6 |
| α-helix | 194 | 1 | |
| β-strand | 196-197 | 2 | 7 |
| β-strand | 204-208 | 5 | 8 |
| β-strand | 212-213 | 2 | 9 |
| β-strand | 218-224 | 7 | 8 |
| β-strand | 225 | 1 | 10 |
| β-strand | 231-236 | 6 | 11 |
| β-strand | 237 | 1 | 12 |
| β-strand | 239 | 1 | 12 |
| β-strand | 243-246 | 4 | 11 |
| β-strand | 248 | 1 | 13 |
| β-strand | 255 | 1 | 10 |
| β-strand | 256 | 1 | 13 |
| β-strand | 258-263 | 6 | 8 |
| α-helix | 266-268 | 3 | |
| β-strand | 270-277 | 8 | 11 |
| β-strand | 283-284 | 2 | 7 |
| α-helix | 285-290 | 6 | |
| β-strand | 291-293 | 3 | 11 |
| β-strand | 294-295 | 2 | 9 |
| β-strand | 304-308 | 5 | 14 |
| β-strand | 312-313 | 2 | 15 |
| β-strand | 319-324 | 6 | 14 |
| β-strand | 331-336 | 6 | 16 |
| α-helix | 340 | 1 | |
| β-strand | 344-347 | 4 | 16 |
| β-strand | 349-351 | 3 | 17 |
| β-strand | 354-356 | 3 | 17 |
| β-strand | 357-361 | 5 | 14 |
| α-helix | 366-368 | 3 | |
| β-strand | 370-377 | 8 | 16 |
| β-strand | 384 | 1 | 9 |
| β-strand | 385 | 1 | 16 |
| α-helix | 387-391 | 5 | |
| β-strand | 392-394 | 3 | 16 |
| β-strand | 395-396 | 2 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leukocyte immunoglobulin-like receptor subfamily B member 2 | A | protein | 396 | Homo sapiens | Q8N423 (AlphaFold model) |
>6AED_1 Leukocyte immunoglobulin-like receptor subfamily B member 2 (chains A) GIQPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQF HIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQ CESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNS PYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERD LRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRG TPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPM SPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVS
Structures of the four Ig-like domain LILRB2 and the four-domain LILRB1 and HLA-G1 complex. Wang, Q., Song, H., Cheng, H. et al. Cell Mol Immunol (2019). DOI 10.1038/s41423-019-0258-5 · PubMed
Other PDB entries of the same protein (UniProt Q8N423 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6AED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.