6AKK: Second Coiled-coil domain of SIKE1

Crystal structure of the second Coiled-coil domain of SIKE1. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Jan 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 909
Mol. weight: 12.94 kDa
Released: 16 Jan 2019

Explore 6AKK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AKK contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	75-118	44

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	75-117	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of IKBKE 1	A, B	protein	54	Homo sapiens	Q9BRV8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6AKK_1 Suppressor of IKBKE 1 (chains A, B)
STMGLLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKA

Primary citation

Architecture, substructures, and dynamic assembly of STRIPAK complexes in Hippo signaling. Tang, Y., Chen, M., Zhou, L. et al. Cell Discov (2019) 5:3-3. DOI 10.1038/s41421-018-0077-3 · PubMed

Other PDB entries of the same protein (UniProt Q9BRV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AKL 1.75 Å, Crystal structure of Striatin3 in complex with SIKE1 Coiled-coil domain
6AKM 2.3 Å, Crystal structure of SLMAP-SIKE1 complex

Browse structure collections

About this viewer

MolViewer shows 6AKK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.