6AL5: Complex between CD19 (N138Q mutant) and B43 FAB

Complex between CD19 (N138Q mutant) and B43 FAB. Determined by X-ray diffraction at 3.0 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,063
Mol. weight: 78.79 kDa
Ligands: NAG
Released: 28 Mar 2018

Explore 6AL5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AL5 contains 24 α-helices and 67 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	22-23	2
β-strand	24-29	6	1
α-helix	33	1
β-strand	34-36	3	2
β-strand	50-53	4	1
β-strand	60-66	7	1
β-strand	71-75	5	2
β-strand	80-84	5	2
β-strand	93-98	6	1
β-strand	108-115	8	1
β-strand	120-123	4	3
β-strand	155-160	6	3
β-strand	163-166	4	3
α-helix	170-172	3
β-strand	187-190	4	1
β-strand	196-198	3	2
α-helix	203-205	3
β-strand	211-218	8	1
β-strand	221-230	10	1
β-strand	239-242	4	2
β-strand	245-248	4	2
α-helix	253-255	3
β-strand	257-262	6	1
β-strand	267-275	9	1
α-helix	276-277	2

Chain H: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	10
β-strand	10-12	3	11
β-strand	18-25	8	10
α-helix	29-31	3
β-strand	34-39	6	11
β-strand	46-52	7	11
β-strand	57-60	4	11
β-strand	68-73	6	10
α-helix	74-76	3
β-strand	78-83	6	10
α-helix	88-90	3
β-strand	92-99	8	11
α-helix	100-102	3
β-strand	103	1	12
β-strand	106	1	12
β-strand	111-114	4	11
β-strand	118-122	5	11
β-strand	128	1	13
α-helix	129-130	2
β-strand	131-135	5	14
β-strand	146-156	11	14
β-strand	157	1	13
β-strand	162-165	4	15
α-helix	166-168	3
β-strand	170	1	15
β-strand	174-176	3	14
α-helix	177-179	3
β-strand	180-181	2	14
β-strand	187-196	10	14
β-strand	205-211	7	15
α-helix	212-214	3
β-strand	216-222	7	15
α-helix	224-226	3

Chain L: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	19-25	7	4
β-strand	30-31	2	6
β-strand	34-35	2	6
β-strand	37-42	6	5
β-strand	49-53	5	5
β-strand	57-58	2	5
α-helix	59	1
β-strand	66	1	4
β-strand	70-71	2	4
β-strand	74-79	6	4
α-helix	84-86	3
β-strand	89-94	6	5
α-helix	100	1
β-strand	101-102	2	5
β-strand	106-110	5	5
α-helix	111	1
β-strand	115	1	7
α-helix	116-117	2
β-strand	118-122	5	8
α-helix	123-125	3
α-helix	126-130	5
β-strand	133-143	11	8
β-strand	144	1	7
β-strand	148-154	7	9
β-strand	157-158	2	9
α-helix	159	1
β-strand	163-167	5	8
β-strand	177-186	10	8
α-helix	187-192	6
β-strand	195-202	8	9
β-strand	209-214	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-lymphocyte antigen CD19	A	protein	265	Homo sapiens	P15391 (AlphaFold model)
B43 light chain	L	protein	218	Homo sapiens	Q6P5S8 (AlphaFold model)
B43 heavy chain	H	protein	233	Homo sapiens	A8K008 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AL5_1 B-lymphocyte antigen CD19 (chains A)
EEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAI
WLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKQRS
SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSC
GVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYY
CHRGNLTMSFHLEITARGSHHHHHH

Sequence of entity 2 (L), FASTA

>6AL5_2 B43 LIGHT CHAIN (chains L)
DIQLTQSPSFLSASVGDRVTITCKASQSVDYSGDSYLNWYQQKPGKAPKLLIYDASNLVS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQSTENPWTFGGGTKLEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (H), FASTA

>6AL5_3 B43 HEAVY CHAIN (chains H)
QVQLVQSGAEVKKPGSSVKVSCKASGYAFSSYWMNWVRQAPGQGLEWMGQIWPGDSDTNY
AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARRETTTVGRYYYAMDYWGQGTTV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of B-cell co-receptor CD19 in complex with antibody B43 reveals an unexpected fold. Teplyakov, A., Obmolova, G., Luo, J. et al. Proteins (2018) 86:495-500. DOI 10.1002/prot.25485 · PubMed

Other PDB entries of the same protein (UniProt P15391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7URV 3.05 Å, FMC63 scFv in complex with soluble CD19
7URX 3.4 Å, SJ25C1 Fab in complex with soluble CD19
7JIC 3.8 Å, Structure of human CD19-CD81 co-receptor complex bound to coltuximab Fab fragment

Browse structure collections

About this viewer

MolViewer shows 6AL5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.