6AT6: KFJ5 TCR

Crystal structure of the KFJ5 TCR. Determined by X-ray diffraction at 1.42 Å resolution. Released 28 Feb 2018.

Method: X-ray diffraction
Resolution: 1.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,066
Mol. weight: 51.56 kDa
Released: 28 Feb 2018

Explore 6AT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AT6 contains 14 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	7
β-strand	15	1	8
β-strand	19-23	5	7
β-strand	28-33	6	8
β-strand	42-48	7	7
β-strand	55-60	6	7
β-strand	65-66	2	8
β-strand	71-73	3	8
β-strand	80-85	6	8
α-helix	90-92	3
β-strand	94-101	8	7
α-helix	104-106	3
β-strand	113	1	2
β-strand	116-121	6	7
β-strand	130-135	6	9
β-strand	136	1	4
β-strand	143-148	6	9
α-helix	157-159	3
β-strand	164-166	3	9
α-helix	167-169	3
β-strand	170-174	5	9
α-helix	175-177	3
β-strand	179-188	10	9
α-helix	195-198	4

Chain B: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
β-strand	14-18	5	2
β-strand	23-29	7	1
β-strand	35-42	8	2
β-strand	46-53	8	2
β-strand	60-61	2	2
β-strand	69-71	3	1
β-strand	77-82	6	1
α-helix	87-89	3
β-strand	91-98	8	2
α-helix	100-102	3
β-strand	107-108	2	2
β-strand	112-117	6	2
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
α-helix	132-134	3
α-helix	135-141	7
β-strand	143-153	11	4
β-strand	154	1	3
β-strand	158-164	7	5
β-strand	167-169	3	5
β-strand	173-175	3	4
α-helix	179	1
β-strand	180-181	2	4
β-strand	191-200	10	4
α-helix	201-204	4
β-strand	210-217	8	5
β-strand	220	1	6
α-helix	231-232	2
β-strand	234	1	6
β-strand	236-243	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor beta variable 28, Human nkt tcr beta chain chimera	B	protein	245	Homo sapiens	A0A5B6 (AlphaFold model), K7N5M4 (AlphaFold model)
T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera	A	protein	208	Homo sapiens	A0A0B4J268 (AlphaFold model), K7N5N2 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>6AT6_1 T-cell receptor beta variable 28, Human nkt tcr beta chain chimera (chains B)
HMDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKG
DIPEGYSVSREKKERFSLILESASTNQTSMYLCASSQRQEGDTQYFGPGTRLTVLEDLKN
VFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKE
QPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA
WGRAD

Sequence of entity 2 (A), FASTA

>6AT6_2 T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera (chains A)
HMLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNE
VASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGEILDNFNKFYFGSGTKLNVKPNIQNPD
PAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWS
NKSDFACANAFNNSIIPEDTFFPSPESS

Primary citation

Divergent T-cell receptor recognition modes of a HLA-I restricted extended tumour-associated peptide. Chan, K.F., Gully, B.S., Gras, S. et al. Nat Commun (2018) 9:1026-1026. DOI 10.1038/s41467-018-03321-w · PubMed

Other PDB entries of the same protein (UniProt A0A5B6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AVF 2.03 Å, Crystal structure of the KFJ5 TCR-NY-ESO-1-HLA-B*07:02 complex
4ZDH 2.1 Å, Crystal structure of JKA6 TCR

Browse structure collections

About this viewer

MolViewer shows 6AT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.