6AYZ: Asf1-Fab 12E complex

Crystal structure of Asf1-Fab 12E complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 6
Atoms: 9,637
Mol. weight: 128.99 kDa
Released: 17 Jan 2018

Explore 6AYZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AYZ contains 47 α-helices and 110 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	24
β-strand	16-17	2	6
α-helix	21	1
β-strand	22-29	8	24
β-strand	38-48	11	6
β-strand	51-62	12	6
β-strand	69-76	8	24
α-helix	77-79	3
α-helix	81-83	3
α-helix	86-89	4
β-strand	92-101	10	6
β-strand	104-117	14	6
α-helix	120-124	5
α-helix	132-134	3
β-strand	135-139	5	6
β-strand	145-148	4	6

Chain B: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	103-107	5	2
β-strand	111-115	5	2
α-helix	118-120	3
β-strand	121	1	3
α-helix	122-123	2
β-strand	124-128	5	4
β-strand	135-136	2	4
β-strand	139-149	11	4
β-strand	150	1	3
β-strand	155-158	4	5
α-helix	159-161	3
β-strand	167-169	3	4
α-helix	170-172	3
β-strand	173-174	2	4
β-strand	180-189	10	4
α-helix	190-192	3
β-strand	199-204	6	5
α-helix	205-207	3
β-strand	209-214	6	5

Chain C: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	18-25	8	6
α-helix	30-32	3
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	85-91	7	7
β-strand	96-98	3	7
β-strand	102-106	5	7
α-helix	107	1
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-154	2	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-197	7	10
β-strand	205-210	6	10

Chain D: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	11
β-strand	10-13	4	12
β-strand	18-24	7	11
α-helix	30-32	3
β-strand	33-38	6	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
α-helix	80-82	3
β-strand	85-91	7	12
β-strand	96-98	3	12
β-strand	102-106	5	12
β-strand	111	1	13
α-helix	112-113	2
β-strand	114-118	5	14
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	14
β-strand	140	1	13
β-strand	145-150	6	15
β-strand	153-154	2	15
α-helix	155	1
β-strand	159-163	5	14
α-helix	164-167	4
β-strand	173-182	10	14
α-helix	183-187	5
β-strand	191-197	7	15
β-strand	205-210	6	15

Chain M: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	16
β-strand	16-17	2	11
α-helix	21	1
β-strand	22-30	9	16
β-strand	34	1	17
β-strand	38-48	11	11
β-strand	51-62	12	11
β-strand	65	1	17
α-helix	66	1
β-strand	68-76	9	16
α-helix	77-79	3
α-helix	81-83	3
α-helix	86-90	5
β-strand	93-101	9	11
β-strand	104-117	14	11
α-helix	120-124	5
α-helix	132-134	3
β-strand	135-139	5	11
β-strand	145-148	4	11

Chain R: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	11-12	2	19
β-strand	18-25	8	18
β-strand	34-39	6	20
β-strand	45-51	7	20
β-strand	58-60	3	20
β-strand	68-73	6	18
β-strand	78-83	6	18
α-helix	88-90	3
β-strand	92-100	9	20
β-strand	103-107	5	20
β-strand	111-113	3	20
β-strand	114-115	2	19
α-helix	118-120	3
β-strand	121	1	21
α-helix	122-123	2
β-strand	124-128	5	22
β-strand	135-136	2	22
β-strand	139-149	11	22
β-strand	150	1	21
β-strand	155-158	4	23
α-helix	159-161	3
β-strand	163	1	23
β-strand	167-169	3	22
α-helix	170-172	3
β-strand	173-174	2	22
β-strand	180-189	10	22
α-helix	190-192	3
β-strand	199-204	6	23
α-helix	205-207	3
β-strand	209-214	6	23
α-helix	217-219	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab Heavy Chain	B, R	protein	224	Homo sapiens
Fab Light Chain	C, D	protein	215	Homo sapiens
Histone chaperone ASF1	A, M	protein	154	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P32447 (AlphaFold model)

Sequence of entity 1 (B, R), FASTA

>6AYZ_1 Fab Heavy Chain (chains B, R)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSYYSIHWVRQAPGKGLEWVASIYPYYGS
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGYGWALDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 2 (C, D), FASTA

>6AYZ_2 Fab Light Chain (chains C, D)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQDGWSLITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (A, M), FASTA

>6AYZ_3 Histone chaperone ASF1 (chains A, M)
GSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSI
LVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEE
ELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD

Primary citation

Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination. Bailey, L.J., Sheehy, K.M., Dominik, P.K. et al. J Mol Biol (2018) 430:337-347. DOI 10.1016/j.jmb.2017.12.012 · PubMed

Other PDB entries of the same protein (UniProt P32447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ROC 1.5 Å, Crystal structure of the histone deposition protein Asf1
5UCB 1.52 Å, Structure of antigen-Fab complex with engineered switch residue region.
2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
5UEK 1.7 Å, Structure of antigen-Fab 12E complex with Histone chaperone ASF1
5UEA 1.7 Å, Structure of antigen-Fab complex with Histone chaperone ASF1
2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
4ZBJ 2.25 Å, UBN1 peptide bound to H3.3/H4/Asf1
4EO5 2.35 Å, Yeast Asf1 bound to H3/H4G94P mutant
5EII 2.44 Å, Structural determination of an protein complex of a Fab with increased solubility
6AZ2 2.48 Å, Crystal structure of Asf1-Fab 12E complex
4RRP 2.79 Å, Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics…
9AWE 2.8 Å, The crystal structure of an engineered Protein GF with Human Kappa Fab

Browse structure collections

About this viewer

MolViewer shows 6AYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.