6AZ2: Asf1-Fab 12E complex
Crystal structure of Asf1-Fab 12E complex. Determined by X-ray diffraction at 2.48 Å resolution. Released 10 Jan 2018.
- Method
- X-ray diffraction
- Resolution
- 2.48 Å
- Organisms
- Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 6
- Atoms
- 8,950
- Mol. weight
- 130.59 kDa
- Released
- 10 Jan 2018
Explore 6AZ2 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6AZ2 contains 37 α-helices and 111 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 45-51 | 7 | 2 |
| β-strand | 58-60 | 3 | 2 |
| β-strand | 68-73 | 6 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 2 |
| β-strand | 108-109 | 2 | 2 |
| β-strand | 113-117 | 5 | 2 |
| β-strand | 122 | 1 | 3 |
| β-strand | 125-129 | 5 | 4 |
| β-strand | 140-150 | 11 | 4 |
| β-strand | 151 | 1 | 3 |
| β-strand | 156-159 | 4 | 5 |
| β-strand | 164 | 1 | 5 |
| β-strand | 168-170 | 3 | 4 |
| α-helix | 171-173 | 3 | |
| β-strand | 174-175 | 2 | 4 |
| β-strand | 181-190 | 10 | 4 |
| α-helix | 191-193 | 3 | |
| β-strand | 194 | 1 | 6 |
| β-strand | 197 | 1 | 6 |
| β-strand | 199-205 | 7 | 5 |
| α-helix | 206-208 | 3 | |
| β-strand | 210-216 | 7 | 5 |
Chain B: 5 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-11 | 8 | 13 |
| β-strand | 16-17 | 2 | 14 |
| α-helix | 21 | 1 | |
| β-strand | 22-30 | 9 | 13 |
| β-strand | 38-45 | 8 | 14 |
| β-strand | 55-62 | 8 | 14 |
| α-helix | 65-66 | 2 | |
| β-strand | 68-76 | 9 | 13 |
| α-helix | 77-78 | 2 | |
| β-strand | 92-101 | 10 | 14 |
| β-strand | 104-117 | 14 | 14 |
| α-helix | 120-124 | 5 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-139 | 5 | 14 |
| β-strand | 145-148 | 4 | 14 |
Chain C: 6 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-51 | 7 | 8 |
| β-strand | 58-60 | 3 | 8 |
| β-strand | 68-73 | 6 | 7 |
| β-strand | 78-83 | 6 | 7 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 8 |
| β-strand | 108-109 | 2 | 8 |
| β-strand | 113-117 | 5 | 8 |
| β-strand | 122 | 1 | 9 |
| α-helix | 123-124 | 2 | |
| β-strand | 125-129 | 5 | 10 |
| β-strand | 140-150 | 11 | 10 |
| β-strand | 151 | 1 | 9 |
| β-strand | 156-159 | 4 | 11 |
| β-strand | 168-170 | 3 | 10 |
| α-helix | 171-173 | 3 | |
| β-strand | 174-175 | 2 | 10 |
| β-strand | 181-190 | 10 | 10 |
| α-helix | 191-193 | 3 | |
| β-strand | 194 | 1 | 12 |
| β-strand | 197 | 1 | 12 |
| β-strand | 199-205 | 7 | 11 |
| α-helix | 206-208 | 3 | |
| β-strand | 210-216 | 7 | 11 |
Chain D: 6 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-11 | 8 | 15 |
| β-strand | 16-17 | 2 | 16 |
| α-helix | 21 | 1 | |
| β-strand | 22-30 | 9 | 15 |
| β-strand | 38-45 | 8 | 16 |
| β-strand | 55-62 | 8 | 16 |
| α-helix | 65-66 | 2 | |
| β-strand | 68-76 | 9 | 15 |
| α-helix | 77-80 | 4 | |
| α-helix | 86-89 | 4 | |
| β-strand | 92-101 | 10 | 16 |
| β-strand | 104-117 | 14 | 16 |
| α-helix | 120-124 | 5 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-139 | 5 | 16 |
| β-strand | 145-148 | 4 | 16 |
Chain E: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-9 | 4 | 17 |
| β-strand | 12-15 | 4 | 18 |
| β-strand | 21-27 | 7 | 17 |
| β-strand | 35-40 | 6 | 18 |
| β-strand | 47-51 | 5 | 18 |
| β-strand | 55-56 | 2 | 18 |
| α-helix | 57 | 1 | |
| β-strand | 64-69 | 6 | 17 |
| β-strand | 72-77 | 6 | 17 |
| α-helix | 82-84 | 3 | |
| β-strand | 86-92 | 7 | 18 |
| β-strand | 95 | 1 | 15 |
| α-helix | 98 | 1 | |
| β-strand | 99-100 | 2 | 18 |
| β-strand | 104-108 | 5 | 18 |
| β-strand | 113 | 1 | 19 |
| β-strand | 116-120 | 5 | 20 |
| α-helix | 125-128 | 4 | |
| β-strand | 131-141 | 11 | 20 |
| β-strand | 142 | 1 | 19 |
| β-strand | 146-152 | 7 | 21 |
| β-strand | 155-156 | 2 | 21 |
| α-helix | 157 | 1 | |
| β-strand | 161-165 | 5 | 20 |
| β-strand | 175-184 | 10 | 20 |
| α-helix | 185-190 | 6 | |
| β-strand | 194-200 | 7 | 21 |
| β-strand | 207-211 | 5 | 21 |
Chain F: 8 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-9 | 4 | 22 |
| β-strand | 12-15 | 4 | 23 |
| β-strand | 21-27 | 7 | 22 |
| β-strand | 35-40 | 6 | 23 |
| β-strand | 47-51 | 5 | 23 |
| β-strand | 55-56 | 2 | 23 |
| α-helix | 57 | 1 | |
| β-strand | 64-69 | 6 | 22 |
| β-strand | 72-77 | 6 | 22 |
| α-helix | 82-84 | 3 | |
| β-strand | 87-92 | 6 | 23 |
| β-strand | 95 | 1 | 13 |
| α-helix | 98 | 1 | |
| β-strand | 99-100 | 2 | 23 |
| β-strand | 104-108 | 5 | 23 |
| β-strand | 113 | 1 | 24 |
| α-helix | 114-115 | 2 | |
| β-strand | 116-120 | 5 | 25 |
| α-helix | 121-123 | 3 | |
| α-helix | 124-127 | 4 | |
| β-strand | 131-141 | 11 | 25 |
| β-strand | 142 | 1 | 24 |
| β-strand | 146-152 | 7 | 26 |
| β-strand | 155-156 | 2 | 26 |
| β-strand | 161-165 | 5 | 25 |
| α-helix | 166-169 | 4 | |
| β-strand | 175-184 | 10 | 25 |
| α-helix | 185-190 | 6 | |
| β-strand | 193-200 | 8 | 26 |
| β-strand | 207-212 | 6 | 26 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Fab Heavy Chain | A, C | protein | 229 | Homo sapiens | |
| Histone chaperone ASF1 | B, D | protein | 154 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P32447 (AlphaFold model) |
| Fab Light Chain | E, F | protein | 215 | Homo sapiens | |
Sequence of entity 1 (A, C), FASTA
>6AZ2_1 Fab Heavy Chain (chains A, C)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSYSSIHWVRQAPGKGLEWVAYIYPSSGY
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYSTKLAMDYWGQGTLVTV
FNQIKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
Sequence of entity 2 (B, D), FASTA
>6AZ2_2 Histone chaperone ASF1 (chains B, D)
GSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSI
LVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEE
ELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Sequence of entity 3 (E, F), FASTA
>6AZ2_3 Fab Light Chain (chains E, F)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSQWYPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Primary citation
Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination. Bailey, L.J., Sheehy, K.M., Dominik, P.K. et al. J Mol Biol (2018) 430:337-347. DOI 10.1016/j.jmb.2017.12.012 · PubMed
Other PDB entries of the same protein (UniProt P32447 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1ROC 1.5 Å, Crystal structure of the histone deposition protein Asf1
- 5UCB 1.52 Å, Structure of antigen-Fab complex with engineered switch residue region.
- 2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
- 5UEK 1.7 Å, Structure of antigen-Fab 12E complex with Histone chaperone ASF1
- 5UEA 1.7 Å, Structure of antigen-Fab complex with Histone chaperone ASF1
- 6AYZ 2.1 Å, Crystal structure of Asf1-Fab 12E complex
- 2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
- 4ZBJ 2.25 Å, UBN1 peptide bound to H3.3/H4/Asf1
- 4EO5 2.35 Å, Yeast Asf1 bound to H3/H4G94P mutant
- 5EII 2.44 Å, Structural determination of an protein complex of a Fab with increased solubility
- 4RRP 2.79 Å, Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics…
- 9AWE 2.8 Å, The crystal structure of an engineered Protein GF with Human Kappa Fab
Browse structure collections
About this viewer
MolViewer shows 6AZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.