Zinc finger Domain of WT1(-KTS form) with 13+1mer Oligonucleotide with 3' Triplet TGT. Determined by X-ray diffraction at 2.79 Å resolution. Released 3 Jan 2018.
Explore 6B0Q in 3D Show helices and sheets RCSB PDB PDBe
6B0Q contains 10 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 323-324 | 2 | 6 |
| β-strand | 333-334 | 2 | 6 |
| α-helix | 337-344 | 8 | |
| β-strand | 353-354 | 2 | 7 |
| β-strand | 357 | 1 | 3 |
| β-strand | 363-364 | 2 | 7 |
| α-helix | 367-373 | 7 | |
| α-helix | 375-378 | 4 | |
| β-strand | 383-384 | 2 | 8 |
| β-strand | 391-392 | 2 | 8 |
| α-helix | 395-406 | 12 | |
| β-strand | 411-412 | 2 | 9 |
| β-strand | 421-422 | 2 | 9 |
| α-helix | 425-435 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 323-324 | 2 | 1 |
| β-strand | 333-334 | 2 | 1 |
| α-helix | 337-344 | 8 | |
| β-strand | 353-354 | 2 | 2 |
| β-strand | 357 | 1 | 3 |
| β-strand | 363-364 | 2 | 2 |
| α-helix | 367-373 | 7 | |
| α-helix | 375-378 | 4 | |
| β-strand | 383-384 | 2 | 4 |
| β-strand | 391-392 | 2 | 4 |
| α-helix | 395-406 | 12 | |
| β-strand | 411-412 | 2 | 5 |
| β-strand | 421-422 | 2 | 5 |
| α-helix | 425-434 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Wilms tumor protein | A, D | protein | 119 | Homo sapiens | P19544 (AlphaFold model) |
| DNA (5'-d(p*gp*cp*gp*tp*gp*gp*gp*ap*gp*tp*gp*tp*t)-3') | B, E | DNA | 14 | Homo sapiens | |
| DNA (5'-d(p*ap*ap*cp*ap*cp*tp*cp*cp*cp*ap*cp*gp*c)-3') | C, F | DNA | 14 | Homo sapiens |
>6B0Q_1 Wilms tumor protein (chains A, D) HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHT GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
>6B0Q_2 DNA (5'-D(P*GP*CP*GP*TP*GP*GP*GP*AP*GP*TP*GP*TP*T)-3') (chains B, E) AGCGTGGGAGTGTT
>6B0Q_3 DNA (5'-D(P*AP*AP*CP*AP*CP*TP*CP*CP*CP*AP*CP*GP*C)-3') (chains C, F) TAACACTCCCACGC
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 8 |
Water and common crystallization additives (SO4) are not listed.
Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Wang, D., Horton, J.R., Zheng, Y. et al. Nucleic Acids Res (2018) 46:3864-3877. DOI 10.1093/nar/gkx1274 · PubMed
Other PDB entries of the same protein (UniProt P19544 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6B0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.