6B0S: Circumsporozoite protein aTSR domain

Crystal structure of circumsporozoite protein aTSR domain in complex with 1710 antibody. Determined by X-ray diffraction at 1.95 Å resolution. Released 8 Nov 2017.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, Plasmodium falciparum
Chains: 3
Atoms: 4,102
Mol. weight: 56.52 kDa
Ligands: IPA
Released: 8 Nov 2017

Explore 6B0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B0S contains 23 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	313-322	10
α-helix	331-334	4
β-strand	338-346	9	13
α-helix	348-350	3
α-helix	355-357	3
α-helix	360-363	4
β-strand	364-372	9	13

Chain H: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	45-51	7	2
β-strand	57-59	3	2
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	98	1	3
α-helix	99-100A	3
β-strand	100C	1	3
β-strand	103	1	2
β-strand	107-111	5	2
α-helix	115-116	2
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
β-strand	136-145	10	5
β-strand	146	1	4
β-strand	151-154	4	6
β-strand	159	1	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-184	9	5
α-helix	186-189	4
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	7
β-strand	9-13	4	8
β-strand	19-24	6	7
α-helix	28-30	3
β-strand	34-38	5	8
β-strand	45-48	4	8
β-strand	49	1	9
β-strand	53	1	9
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-92	9	8
β-strand	95-98	4	8
β-strand	102-106	5	8
α-helix	109-111	3
β-strand	112	1	10
α-helix	113-114	2
β-strand	115-119	5	11
α-helix	120-122	3
α-helix	123-127	5
β-strand	131-140	10	11
β-strand	141	1	10
β-strand	146-151	6	12
β-strand	154-155	2	12
α-helix	156	1
β-strand	160-162	3	11
α-helix	163-165	3
β-strand	166-167	2	11
β-strand	173-181	9	11
α-helix	183-188	6
β-strand	192-198	7	12
β-strand	201-207	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1710 antibody, heavy chain	H	protein	226	Homo sapiens
1710 antibody, light chain	L	protein	213	Homo sapiens
Circumsporozoite protein	C	protein	82	Plasmodium falciparum	P19597 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>6B0S_1 1710 antibody, heavy chain (chains H)
EVQLQESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSITSSSSYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDPGIAAADNHWFDPWGQGTLVT
VSSASTKGPSVFPLAPSSSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Sequence of entity 2 (L), FASTA

>6B0S_2 1710 antibody, light chain (chains L)
SAYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVVVIYQDTKRPSGIPE
RFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLGQPKAAPSVTLFP
PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS
LTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 3 (C), FASTA

>6B0S_3 Circumsporozoite protein (chains C)
ETGYVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYAN
DIEKKICKMEKCPHHHHHHALE

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Rare PfCSP C-terminal antibodies induced by live sporozoite vaccination are ineffective against malaria infection. Scally, S.W., Murugan, R., Bosch, A. et al. J Exp Med (2018) 215:63-75. DOI 10.1084/jem.20170869 · PubMed

Other PDB entries of the same protein (UniProt P19597 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O24 1.4 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein NANP3 and…
8FDD 1.54 Å, Crystal structure of Ky15.3 Fab in complex with circumsporozoite protein NPDP peptide
8FAS 1.55 Å, Crystal structure of Ky230 Fab in complex with circumsporozoite protein NANP5 peptide
6VLN 1.63 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein DND3 and…
8FB8 1.69 Å, Crystal structure of Ky15.10-Y100EK Fab in complex with circumsporozoite protein KQPA…
6ULF 1.7 Å, Crystal structure of 4498 Fab in complex with circumsporozoite protein NDN3 and…
8F9U 1.7 Å, Crystal structure of Ky15.7 Fab in complex with circumsporozoite protein NPDP peptide
8FB7 1.75 Å, Crystal structure of Ky15.10 Fab in complex with circumsporozoite protein NPDP peptide
6O26 1.8 Å, Crystal structure of 3246 Fab in complex with circumsporozoite protein NANA
8FA7 1.8 Å, Crystal structure of Ky15.11 Fab in complex with circumsporozoite protein KQPA peptide
8FA8 1.8 Å, Crystal structure of Ky15.11 Fab in complex with circumsporozoite protein NDN peptide
8FDC 1.8 Å, Crystal structure of Ky311 Fab in complex with circumsporozoite protein KQPA peptide

Browse structure collections

About this viewer

MolViewer shows 6B0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.