6B7G: BCoR

Solution NMR structure of BCoR in complex with AF9 (BCoR-AF9). Determined by solution NMR. Released 10 Oct 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 840
Mol. weight: 11.99 kDa
Released: 10 Oct 2018

Explore 6B7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B7G contains 4 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	501-513	13
α-helix	520-527	8
α-helix	530-533	4
β-strand	537-539	3	1
β-strand	542-546	5	1
α-helix	552-563	12

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1195-1199	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein AF-9	A	protein	70	Homo sapiens	P42568 (AlphaFold model)
BCL-6 corepressor	B	protein	33	Homo sapiens	Q6W2J9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6B7G_1 Protein AF-9 (chains A)
MDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKL
QSYLETSGTS

Sequence of entity 2 (B), FASTA

>6B7G_2 BCL-6 corepressor (chains B)
TTNSSSNHLEDPHYSELTNLKVCIELTGLHPKK

Primary citation

BCOR Binding to MLL-AF9 Is Essential for Leukemia via Altered EYA1, SIX, and MYC Activity. Schmidt, C.R., Achille, N.J., Kuntimaddi, A. et al. Blood Cancer Discov (2020) 1:162-177. DOI 10.1158/2643-3230.BCD-20-0036 · PubMed

Other PDB entries of the same protein (UniProt P42568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PJ7 1.26 Å, MLLT3 in complex with compound PFI-6
7VKG 1.83 Å, Crystal structure of AF9 YEATS domain in complex with Compound 10
5YYF 1.9 Å, Crystal structure of AF9 YEATS domain in complex with a peptide inhibitor…
6MIL 1.93 Å, Crystal structure of AF9 YEATS domain in complex with histone H3K9bu
7EIC 1.95 Å, Crystal structure of AF9 YEATS domain in complex with H4K5acK8ac peptide
7EID 2.0 Å, Crystal structure of AF9 YEATS domain in complex with H4K8acK12ac peptide
8TLX 2.1 Å, Crystal structure of MBP and AF9 AHD fusion protein 3AQA in complex with peptidomimetic…
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
8TLW 2.11 Å, Crystal structure of MBP and AF9 AHD fusion protein 3AQA in complex with peptidomimetic…
6LS6 2.2 Å, Crystal Structure of YEATS domain of AF9 in complex with H3K9bz peptide
7VKH 2.25 Å, Crystal structure of AF9 YEATS domain in complex with hit 2
4TMP 2.3 Å, Crystal structure of AF9 YEATS bound to H3K9ac peptide

Browse structure collections

About this viewer

MolViewer shows 6B7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.