6BHR: HIV-1 immature CTD-SP1 hexamer

HIV-1 immature CTD-SP1 hexamer in complex with IP6. Determined by X-ray diffraction at 2.91 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.91 Å
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Chains: 1
Atoms: 705
Mol. weight: 11.14 kDa
Ligands: IHP
Released: 8 Aug 2018

Explore 6BHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BHR contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	293-304	12
α-helix	311-324	14
α-helix	328-337	10
α-helix	343-350	8
α-helix	356-369	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein p24,Spacer peptide 1	G	protein	95	Human immunodeficiency virus type 1 group M subtype B (isolate BH10)	P03347

Sequence of entity 1 (G), FASTA

>6BHR_1 Capsid protein p24,Spacer peptide 1 (chains G)
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKAL
GPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTN

Ligands and cofactors

ID	Name	Formula	Copies
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	1

Primary citation

Inositol phosphates are assembly co-factors for HIV-1. Dick, R.A., Zadrozny, K.K., Xu, C. et al. Nature (2018) 560:509-512. DOI 10.1038/s41586-018-0396-4 · PubMed

Other PDB entries of the same protein (UniProt P03347), best resolution first:

2BUO 1.7 Å, HIV-1 capsid C-terminal domain in complex with an inhibitor of particle assembly
5KP9 5.7 Å, Structure of Nanoparticle Released from Enveloped Protein Nanoparticle

Browse structure collections

About this viewer

MolViewer shows 6BHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.