Crystal structure of Hendra virus matrix protein. Determined by X-ray diffraction at 2.5 Å resolution. Released 25 Apr 2018.
Explore 6BK6 in 3D Show helices and sheets RCSB PDB PDBe
6BK6 contains 14 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46-50 | 5 | 1 |
| α-helix | 54-56 | 3 | |
| β-strand | 62-73 | 12 | 1 |
| β-strand | 86-98 | 13 | 1 |
| α-helix | 103-111 | 9 | |
| β-strand | 114-121 | 8 | 1 |
| β-strand | 125-132 | 8 | 1 |
| α-helix | 139-141 | 3 | |
| α-helix | 142-146 | 5 | |
| β-strand | 149-152 | 4 | 1 |
| α-helix | 153-156 | 4 | |
| β-strand | 157 | 1 | 1 |
| α-helix | 160-162 | 3 | |
| β-strand | 169-181 | 13 | 1 |
| α-helix | 191-194 | 4 | |
| β-strand | 201-211 | 11 | 2 |
| β-strand | 232-243 | 12 | 2 |
| α-helix | 252-260 | 9 | |
| β-strand | 264-269 | 6 | 3 |
| α-helix | 271-273 | 3 | |
| β-strand | 275-280 | 6 | 3 |
| α-helix | 286-291 | 6 | |
| β-strand | 297-301 | 5 | 3 |
| α-helix | 302-305 | 4 | |
| α-helix | 307-311 | 5 | |
| β-strand | 319-329 | 11 | 2 |
| α-helix | 333-335 | 3 | |
| α-helix | 338-340 | 3 | |
| β-strand | 341-343 | 3 | 2 |
| β-strand | 348-349 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hendra virus matrix protein | A | protein | 372 | Hendra henipavirus | O89341 (AlphaFold model) |
>6BK6_1 Hendra virus matrix protein (chains A) MGHHHHHHGTENLYFQGSMDFSVSDNLDDPIEGVSDFSPTSWENGGYLDKVEPEIDKHGS MIPKYKIYTPGANERKFNNYMYMICYGFVEDVERSPESGKRKKIRTIAAYPLGVGKSTSH PQDLLEELCSLKVTVRRTAGATEKIVFGSSGPLHHLLPWKKILTGGSIFNAVKVCRNVDQ IQLEKQQSLRIFFLSITKLNDSGIYMIPRTMLEFRRNNAIAFNLLVYLKIDADLAKAGIQ GSFDKDGTKVASFMLHLGNFVRRAGKYYSVEYCKRKIDRMKLQFSLGSIGGLSLHIKING VISKRLFAQMGFQKNLCFSLMDINPWLNRLTWNNSCEISRVAAVLQPSVPREFMIYDDVF IDNTGKILKGAS
Electrostatic Interactions between Hendra Virus Matrix Proteins Are Required for Efficient Virus-Like-Particle Assembly. Liu, Y.C., Grusovin, J., Adams, T.E. J Virol (2018) 92. DOI 10.1128/JVI.00143-18 · PubMed
Other PDB entries of the same protein (UniProt O89341 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.