8FUC: Mouse Importin alpha

Crystal structure of mouse Importin alpha in complex with Hendra virus matrix protein minor site NLS2. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Jan 2023.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Hendra virus horse/Australia/Hendra/1994, Mus musculus, Escherichia coli BL21(DE3)
Chains: 3
Atoms: 3,605
Mol. weight: 58.26 kDa
Released: 25 Jan 2023

Explore 8FUC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FUC contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	78-86	9
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-127	7
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-211	6
α-helix	218-220	3
α-helix	223-237	15
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-363	15
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-452	19
α-helix	457-466	10
α-helix	469-476	8
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein	A	protein	18	Hendra virus horse/Australia/Hendra/1994	O89341 (AlphaFold model)
Importin subunit alpha-1	B	protein	510	Mus musculus	P52293 (AlphaFold model)
Contaminant peptide KKLARE	F	protein	6	Escherichia coli BL21(DE3)

Sequence of entity 1 (A), FASTA

>8FUC_1 Matrix protein (chains A)
VRRAGKYYSVEYCKRKID

Sequence of entity 2 (B), FASTA

>8FUC_2 Importin subunit alpha-1 (chains B)
MHHHHHHSSGLVPRGSGMLETAAALFERNHMDSPDLGTDDDDLAMADIGSNQGTVNWSVE
DIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFE
SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDL
VIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRL
LHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGN
IVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV
PFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQV
ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVE
EEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Sequence of entity 3 (F), FASTA

>8FUC_3 Contaminant peptide KKLARE (chains F)
KKLARE

Primary citation

Henipavirus Matrix Protein Employs a Non-Classical Nuclear Localization Signal Binding Mechanism. Donnelly, C.M., Vogel, O.A., Edwards, M.R. et al. Viruses (2023) 15. DOI 10.3390/v15061302 · PubMed

Other PDB entries of the same protein (UniProt O89341 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FUA 1.9 Å, Crystal structure of mouse Importin alpha in complex with Hendra virus matrix protein NLS1
6BK6 2.5 Å, Crystal structure of Hendra virus matrix protein
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 8FUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.