6BLQ: IAg7

Crystal Structure of IAg7 in complex with insulin mimotope p8E9E. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,642
Mol. weight: 48.06 kDa
Ligands: IPA, NAG
Released: 20 Dec 2017

Explore 6BLQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BLQ contains 16 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	-1-1	3
β-strand	4-15	12	1
β-strand	19-26	8	1
β-strand	29-35	7	1
β-strand	40-43	4	1
α-helix	46-49	4
β-strand	52-53	2	2
α-helix	57-76	20
α-helix	80-85	6
β-strand	88-93	6	3
β-strand	103-112	10	3
β-strand	118-123	6	4
β-strand	126-128	3	4
β-strand	132-134	3	3
α-helix	137	1
β-strand	138-139	2	3
β-strand	145-153	9	3
β-strand	161-166	6	4
β-strand	174-178	5	4

Chain B: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	-26--25	2	2
α-helix	-24--23	2
α-helix	-18--15	4
β-strand	9-20	12	1
β-strand	25-34	10	1
β-strand	37-43	7	1
β-strand	48-51	4	1
α-helix	54-56	3
α-helix	57-66	10
α-helix	68-74	7
α-helix	75-80	6
α-helix	81	1
α-helix	82-87	6
α-helix	91-93	3
β-strand	96	1	5
α-helix	97-98	2
β-strand	99-103	5	6
β-strand	115-123	9	6
β-strand	124	1	5
β-strand	129-134	6	7
β-strand	137-139	3	7
β-strand	143-145	3	6
α-helix	146-148	3
β-strand	149-150	2	6
β-strand	156-163	8	6
β-strand	171-177	7	7
β-strand	185-190	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, A-D alpha chain	A	protein	185	Mus musculus	P04228 (AlphaFold model)
H2-Ab1 protein	B	protein	221	Mus musculus	Q31135 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BLQ_1 H-2 class II histocompatibility antigen, A-D alpha chain (chains A)
EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEP
QGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPV
INITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLK
HWEPE

Sequence of entity 2 (B), FASTA

>6BLQ_2 H2-Ab1 protein (chains B)
HLVERLYLVCGEEGAGGGSLVGGSGGGSERHFVHQFKGECYFTNGTQRIRLVTRYIYNRE
EYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQ
PNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQ
VLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQGGLVPR

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes. Wang, Y., Sosinowski, T., Novikov, A. et al. Proc Natl Acad Sci U S A (2018) 115:162-167. DOI 10.1073/pnas.1716527115 · PubMed

Other PDB entries of the same protein (UniProt P04228 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QHP 1.82 Å, Structure of I-Ag7 with a bound hybrid insulin peptide
6BLR 1.96 Å, Crystal Structure of IAg7 in complex with insulin mimotope p8E9E6SS
6BLX 2.32 Å, Crystal structure of IAg7 in complex with insulin mimotope p8G9E
2IAD 2.4 Å, Class II MHC I-ad in complex with an influenza hemagglutinin peptide 126-138
5DMK 2.45 Å, Crystal Structure of IAg7 in complex with RLGL-WE14
1ES0 2.6 Å, Crystal structure of the murine class II allele I-A(G7) complexed with the glutamic acid…
1IAO 2.6 Å, Class II MHC I-ad in complex with ovalbumin peptide 323-339
7Z50 2.65 Å, Structure of the highly diabetogenic 4.1-T cell receptor targeting a hybrid insulin…
3MBE 2.89 Å, TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
7RDV 2.9 Å, TFH TCR bound to MHC Class II IAd presenting aggrecan epitope
3CUP 3.09 Å, Crystal structure of the MHC class II molecule I-Ag7 in complex with the peptide…
1F3J 3.1 Å, Histocompatibility antigen I-AG7

Browse structure collections

About this viewer

MolViewer shows 6BLQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.