6BLR: IAg7

Crystal Structure of IAg7 in complex with insulin mimotope p8E9E6SS. Determined by X-ray diffraction at 1.96 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,441
Mol. weight: 46.32 kDa
Released: 20 Dec 2017

Explore 6BLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BLR contains 13 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-17	12	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	42-45	4	1
α-helix	48-51	4
β-strand	54-55	2	2
α-helix	59-78	20
α-helix	82-87	6
β-strand	90-95	6	3
β-strand	105-114	10	3
β-strand	120-125	6	4
β-strand	128-130	3	4
β-strand	135-136	2	3
α-helix	139	1
β-strand	140-141	2	3
β-strand	147-155	9	3
β-strand	163-168	6	4
β-strand	176-179	4	4

Chain B: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	-26--25	2	2
α-helix	-18--16	3
β-strand	8-19	12	1
β-strand	24-33	10	1
β-strand	36-42	7	1
β-strand	47-50	4	1
α-helix	53-55	3
α-helix	56-73	18
α-helix	74-79	6
α-helix	80	1
α-helix	81-86	6
β-strand	95	1	5
α-helix	96-97	2
β-strand	98-102	5	6
β-strand	114-122	9	6
β-strand	123	1	5
β-strand	128-133	6	7
β-strand	136-137	2	7
α-helix	138	1
β-strand	139	1	8
β-strand	141	1	8
β-strand	142-144	3	6
α-helix	145-147	3
β-strand	148-149	2	6
β-strand	155-162	8	6
β-strand	171-176	6	7
β-strand	184-188	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IAg7 alpha chain	A	protein	183	Mus musculus	P04228 (AlphaFold model)
H2-Ab1 protein	B	protein	221	Mus musculus	Q31135 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BLR_1 IAg7 alpha chain (chains A)
DIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQG
GLQCIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVIN
ITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHW
EPE

Sequence of entity 2 (B), FASTA

>6BLR_2 H2-Ab1 protein (chains B)
HLVERLYLVCGEEGAGGGSLVGGSGGGSERHFVHQFKGECYFTNGTQRIRLVTRYIYNRE
EYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQ
PNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQ
VLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQGGLVPR

Primary citation

C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes. Wang, Y., Sosinowski, T., Novikov, A. et al. Proc Natl Acad Sci U S A (2018) 115:162-167. DOI 10.1073/pnas.1716527115 · PubMed

Other PDB entries of the same protein (UniProt P04228 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BLQ 1.8 Å, Crystal Structure of IAg7 in complex with insulin mimotope p8E9E
7QHP 1.82 Å, Structure of I-Ag7 with a bound hybrid insulin peptide
6BLX 2.32 Å, Crystal structure of IAg7 in complex with insulin mimotope p8G9E
2IAD 2.4 Å, Class II MHC I-ad in complex with an influenza hemagglutinin peptide 126-138
5DMK 2.45 Å, Crystal Structure of IAg7 in complex with RLGL-WE14
1ES0 2.6 Å, Crystal structure of the murine class II allele I-A(G7) complexed with the glutamic acid…
1IAO 2.6 Å, Class II MHC I-ad in complex with ovalbumin peptide 323-339
7Z50 2.65 Å, Structure of the highly diabetogenic 4.1-T cell receptor targeting a hybrid insulin…
3MBE 2.89 Å, TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
7RDV 2.9 Å, TFH TCR bound to MHC Class II IAd presenting aggrecan epitope
3CUP 3.09 Å, Crystal structure of the MHC class II molecule I-Ag7 in complex with the peptide…
1F3J 3.1 Å, Histocompatibility antigen I-AG7

Browse structure collections

About this viewer

MolViewer shows 6BLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.